SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|186471156|ref|YP_001862474.1|NC_010625 from NCBI plasmid sequences

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|186471156|ref|YP_001862474.1|NC_010625
Domain Number 1 Region: 4-184
Classification Level Classification E-value
Superfamily Methylesterase CheB, C-terminal domain 1.7e-46
Family Methylesterase CheB, C-terminal domain 0.0001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|186471156|ref|YP_001862474.1|NC_010625
Sequence length 330
Comment CheB methylesterase [Burkholderia phymatum STM815 plasmid pBPHY01]
Sequence
MTHRDFIAVGASAGGVDALRDLASRFPPDLPATVAIVLHVGPHESLLPSLLSAAGPLEAR
HAEDGQIYARGKIYVAPPDRHLIVDGTRLRLVHGAKENFARPAIDPLFRSTALEMGPRAI
GVVLTGLLDDGAAGLEAIQACGGATLVQDPADAFARDMPLNASPFADYILPVAGLAARLV
QLVGGTPPAPGKTESACHATAHRRITTEQHAWIGDRSPVEALRELGVPSMFTCPDCNGSL
WQVNGSRLLRYRCHTGHAYTTGSLASGREDDVERSMMDAMRALQEREMACRARGEFFGKQ
GDTAAQTREEEIARRANEAAGLLQSLLLER
Download sequence
Identical sequences B2JWV1
391038.Bphy_6398 gi|186471156|ref|YP_001862474.1|NC_010625 WP_012405587.1.55900 gi|186471156|ref|YP_001862474.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]