SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|186471157|ref|YP_001862475.1|NC_010625 from NCBI plasmid sequences

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|186471157|ref|YP_001862475.1|NC_010625
Domain Number 1 Region: 14-197
Classification Level Classification E-value
Superfamily Methylesterase CheB, C-terminal domain 1.44e-54
Family Methylesterase CheB, C-terminal domain 0.00012
Further Details:      
 
Domain Number 2 Region: 290-483
Classification Level Classification E-value
Superfamily S-adenosyl-L-methionine-dependent methyltransferases 7.56e-50
Family Chemotaxis receptor methyltransferase CheR, C-terminal domain 0.00021
Further Details:      
 
Domain Number 3 Region: 1054-1221
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 1.96e-41
Family Histidine kinase 0.00039
Further Details:      
 
Domain Number 4 Region: 1241-1360
Classification Level Classification E-value
Superfamily CheY-like 1.15e-30
Family CheY-related 0.025
Further Details:      
 
Domain Number 5 Region: 841-965
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 1.3e-21
Family Heme-binding PAS domain 0.01
Further Details:      
 
Domain Number 6 Region: 223-291
Classification Level Classification E-value
Superfamily Chemotaxis receptor methyltransferase CheR, N-terminal domain 0.0000000000000549
Family Chemotaxis receptor methyltransferase CheR, N-terminal domain 0.0059
Further Details:      
 
Domain Number 7 Region: 990-1066
Classification Level Classification E-value
Superfamily Homodimeric domain of signal transducing histidine kinase 0.000000000000294
Family Homodimeric domain of signal transducing histidine kinase 0.0036
Further Details:      
 
Domain Number 8 Region: 748-854
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.0000000019
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.08
Further Details:      
 
Domain Number 9 Region: 526-632
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.00000119
Family Flavin-binding PAS domain 0.09
Further Details:      
 
Weak hits

Sequence:  gi|186471157|ref|YP_001862475.1|NC_010625
Domain Number - Region: 655-775
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0377
Family Extended AAA-ATPase domain 0.076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|186471157|ref|YP_001862475.1|NC_010625
Sequence length 1361
Comment signal transduction histidine kinase with CheB and CheR activity [Burkholderia phymatum STM815 plasmid pBPHY01]
Sequence
MPKKRAQTLPSQANFPIVGIGASAGGLSALREFFEALPAHTSMAFVVIVHLAPDHESNLA
SLLQKTTDMPVLEVTSATPIEPDHVYLIAPSLELTMVDDYLRVMPRQPDDGRRAAIDLFF
RTLAEAHRERAIGIVLSGAGSDGSVGLSRVKEMGGITLAQDPAEAEYDSMPRSAIATGMV
DFVLTAAEMPQRLLDLWLTTKEIHLPIAEGDERDETISNESAERALREIMVILRTRTGHD
FRHYKRATVLRRIERRMQVNGITDLQAYRDHLHLHQDETQALLQDMLISVTNFFRDKEAF
EVLEREVLPQLFEGRGEQDRIRTWSVGCATGEEAYSLAMLLQERSLKSAEGVSFQVFATD
IDERAISFARAGLYPDSILADVSTSRVRQFFSKDAAHYRVKKELREHMLFAHHNVLSDPP
FSRLDLICCRNLLIYLDREAQIEILKMFHFALRPGGVLFLGSSESADSVSSMFSVIDKRN
RIYRANMAVRGDTPVPVAISGMASARPVVATVQPPGRRRFSFGDLHQRLVEQYAPPSVLV
SRDSEIVHLSDRAGRFLQYSGGEPSHNIVAVVRPELRLELRTAIYQALHTNRSVEARRVR
IEHEGRSYFVNMTARPVHDPEANADFVLVLFDEVEDSMGGSETSASDAQKDPIISQLERE
LQRTKEQLQSTIEQSETSTEELKASNEELQAINEELRSATEELETSKEELQSINEELTTV
NAELKSKVEETGKINDDLQNLIAANDIGTIFVDRNICIKRYTPRATDVFSIIPSDIGRSL
LDITHRLEYDKLADDAAEAFDSLRLIERELKSNDGRWYLARFVPYRTTEDRIDGAVLSFI
DITGRRQAEDRLREGERRMRIVAEGTKDYAIITFDDEGLVTSWNAGAERIFGYTEAEMIG
QSADMLSTEEDRASNIAQAEFAEARLNGRTEEERWHVRKDGTRFFASGVLSRLDEAGVSG
FAKIARDLGEFGHVATTERGSHTETLRAAAERDAQRRRDEFLAVVSHELKHPLNLISASA
ELIARAPETRQSLNISRAADTIRRTVIGQAQIIDDLLDISRVRTGKLSIIRTAVDMREIV
QRVCNAVQDDARQRGLTLNVTMAESPVIIHADLTRVEQVVWNLVSNAMKFTNRGSVDVSL
RVNEHGEAVLRVSDTGKGIEPSLLPHIFEMFEQSRDPVTRRSGLGIGLALVRELVNLHGG
AVRAESEGVGRGSTFTVTLPTHRTLSYASGADGDAAVDSLRGVRVLMVDDDAATTETFKL
LLESEGAIVKTAASGEEALAMLNGDVPDVVLSDIGMHGMDGLEFVGKLREEPGLKSVICI
ALSGFGQEADVKMAENAGFDAHLKKPVMLEDLLHVVSRLRH
Download sequence
Identical sequences B2JWV2
391038.Bphy_6399 gi|186471157|ref|YP_001862475.1|NC_010625 WP_012405588.1.55900 gi|186471157|ref|YP_001862475.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]