SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|186471778|ref|YP_001863096.1|NC_010625 from NCBI plasmid sequences

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|186471778|ref|YP_001863096.1|NC_010625
Domain Number 1 Region: 4-188
Classification Level Classification E-value
Superfamily Methylesterase CheB, C-terminal domain 1.57e-52
Family Methylesterase CheB, C-terminal domain 0.0000929
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|186471778|ref|YP_001863096.1|NC_010625
Sequence length 350
Comment CheB methylesterase [Burkholderia phymatum STM815 plasmid pBPHY01]
Sequence
MKGRIFVIGASQGGIEAISALIAQLPADFPAPVFVAQHIAASSLGGLPRILGRAGSLPAA
HPRDMEIFERGKVYVAPPDRHMLLQRGYVCLSRGPRENHVRPAIDPLFRSAASAYGAAVV
GVILTGHLDDGTAGLMAVKDRGGVAIVQDHAEAVAPSMPRSAHAHVSIDHCCTLSKMGAI
LVDLASDDVGSQVPAANPLIEVETRIAAGELNLAEWSRFEKLSAPSGFRCPACGSALFEV
RDDRMIRFRCRAGHAFSARCLLEEQAQMREKAIAGLYDLLMEEATLASRLLNLSGDDDSG
LRTAISDRVSDARRNAALAGQWLAYPQGGQARREQSLAPSRNPSDFDSRR
Download sequence
Identical sequences B2JTZ7
WP_012406206.1.55900 391038.Bphy_7044 gi|186471778|ref|YP_001863096.1|NC_010625 gi|186471778|ref|YP_001863096.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]