SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|190894268|ref|YP_001984562.1|NC_010996 from NCBI plasmid sequences

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|190894268|ref|YP_001984562.1|NC_010996
Domain Number - Region: 171-220
Classification Level Classification E-value
Superfamily Enzyme IIa from lactose specific PTS, IIa-lac 0.0915
Family Enzyme IIa from lactose specific PTS, IIa-lac 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|190894268|ref|YP_001984562.1|NC_010996
Sequence length 242
Comment hypothetical protein RHECIAT_PB0000305 [Rhizobium etli CIAT 652 plasmid pB]
Sequence
MLFQHNISHPVDSPRPLILKKVQRSFAVEYKNGRRKLDARSNSIWGNVDLKSVARDLEEE
ALPFLSGSSQSGKPDSEMSLPEQDQAEQLLTAPLGPSTTASDTQEMSMADETNTTTKVDG
QTVVETPNAPKKQRKPRAKKVAALETALADATAEPAAALAGDGGVKRRGRKTKAIEATAS
AKRAPVRRAPKAVQAAPAAPMTASDEMADLLQLEEENQRLRKLLAGKLRAENEDLRKRLK
LD
Download sequence
Identical sequences A0A1W6KVG9 B3Q2V6 Q8KLF0
gi|89255378|ref|NP_659775.2| gi|190894268|ref|YP_001984562.1|NC_010996 gi|89255378|ref|NP_659775.2|NC_004041 gi|190894268|ref|YP_001984562.1| 347834.RHE_PD00265 491916.RHECIAT_PB0000305

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]