SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|209547249|ref|YP_002279167.1|NC_011368 from NCBI plasmid sequences

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|209547249|ref|YP_002279167.1|NC_011368
Domain Number 1 Region: 293-485
Classification Level Classification E-value
Superfamily S-adenosyl-L-methionine-dependent methyltransferases 4.95e-47
Family Chemotaxis receptor methyltransferase CheR, C-terminal domain 0.0003
Further Details:      
 
Domain Number 2 Region: 25-206
Classification Level Classification E-value
Superfamily Methylesterase CheB, C-terminal domain 2.09e-23
Family Methylesterase CheB, C-terminal domain 0.00058
Further Details:      
 
Domain Number 3 Region: 970-1102
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 1.43e-19
Family Heme-binding PAS domain 0.017
Further Details:      
 
Domain Number 4 Region: 848-956
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 2.09e-18
Family Heme-binding PAS domain 0.023
Further Details:      
 
Domain Number 5 Region: 228-295
Classification Level Classification E-value
Superfamily Chemotaxis receptor methyltransferase CheR, N-terminal domain 0.0000000000366
Family Chemotaxis receptor methyltransferase CheR, N-terminal domain 0.01
Further Details:      
 
Domain Number 6 Region: 727-848
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.000000419
Family Heme-binding PAS domain 0.033
Further Details:      
 
Weak hits

Sequence:  gi|209547249|ref|YP_002279167.1|NC_011368
Domain Number - Region: 659-752
Classification Level Classification E-value
Superfamily Tropomyosin 0.00262
Family Tropomyosin 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|209547249|ref|YP_002279167.1|NC_011368
Sequence length 1324
Comment MCP methyltransferase/methylesterase, CheR/CheB with PAS/PAC sensor [Rhizobium leguminosarum bv. trifolii WSM2304 plasmid pRLG201]
Sequence
MAYEEQEYMEQGAGAAQPGRHVQPLVIVGIAVSEQSLSSLEQIFSEVDVGLSASYLVAVH
QQKGLSTATVLGLLGRQNRLSVTVAADGARLLQNQIYISGSDDVVTLEDGHIRVRPASEP
VGHRGTVDTMLISLAEHAGERAIVVVLLGLENDGTAAVAATKNFGGLSIVEIGENANTSF
EDGRGAVAIADLRLPAQSIASQIALHASNVNENEDAGIGDETPSALEAQITQIATVLRNI
TSHDFHGYKRGTFSRRVHRRMQVLQIVSIDAYIERLRASRDEVQDLFQDLLIGVTQFFRD
PAEFEALEREIPKLFEGKGASDKFRVWVLGCATGEEAYSIAMLLREHVSTMDYPPEVQIF
ATDLDARALGIARAGRYSAAITSHVPPERLARWFVREGDTYCVVKELREMCIFSPHNIVK
DAPFSRIDILSCRNLLIYLDNELQNRVMPIFHFALRPSGILFLGSSENVTRHAKLFASVD
RKNRLFRRLETATRIIPDFPLSPRPRSPDHPFSPPAPMLQTGRLSATISRQAEVVAERFA
PAYVVVDSHYDVLHFSGRTGRYLEPTSGTATLNLLSLAHRDLRLDMRSALQRATAEAVKV
EVPRVLLHQDDRSYAVNIIVEPLGSGDVTSLIVLFQDAGQVAEGTALDGGRLTSEEHVQR
LETDLRLTRDRLQATIEELESTNEELKSSNEEYQSINEELQSANEEMETSKEELQSVNEE
LQTVNGELAHRVAELDRANSDLKNLLEATQIATVFLDNDLRVRSFTPAATEIFHLLETDV
GRPLDHVVSRVAYPQLLDDVRLVLRTLMPVDRKVSDPTDNRHYAARALPYRSVDNYIGGA
VVTFTDLTATYEAEMALRRSEERLQRVLETDAVGVVFLNKDGVIVDANEVFLKMSGYSRS
QMGRPELHWRRLTPSEHIAETEAQMEALTETGRMGPYEKEYLLADGARRWMLFAGRDLGD
GTIAEFCIDISARKQAQAALRQEEEQFRLFGEASSDVLWIRDAETLEWNYLAPAFEAIYG
VERQQALRDNNFRNWVELIIPEDREKALSEIRRVRNGERAEYEYRIRRASDHEIRWLRNA
EFPLFREEGTFTQIGGIGRDITDEKVSADRMKILVGELQHRTRNLMAVVRSMADKTLRTS
TDLADFHKKFRDRLDVMARVQGFLSRLQDGGRITFDQLIRSELSSHGVAEGETSRVFLQG
PDGVRLRSTTVQTMALAIHELATNAIKYGALCQPQAHLAIVWRVEKQGENAKPWLHVDWR
ESRVKMPPAGSGPQGGGQGRELIERALPYQLDAKTSYALGEDGVHCTIAIPVSLSNLIEV
DGHG
Download sequence
Identical sequences B6A1E3
gi|209547249|ref|YP_002279167.1| gi|209547249|ref|YP_002279167.1|NC_011368 WP_012556096.1.20038 395492.Rleg2_5237

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]