SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|218533310|ref|YP_002424125.1|NC_011758 from NCBI plasmid sequences

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|218533310|ref|YP_002424125.1|NC_011758
Domain Number 1 Region: 4-132
Classification Level Classification E-value
Superfamily CheY-like 1.42e-30
Family CheY-related 0.00081
Further Details:      
 
Domain Number 2 Region: 141-210
Classification Level Classification E-value
Superfamily C-terminal effector domain of the bipartite response regulators 7.48e-18
Family GerE-like (LuxR/UhpA family of transcriptional regulators) 0.0071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|218533310|ref|YP_002424125.1|NC_011758
Sequence length 218
Comment LuxR family transcriptional regulator [Methylobacterium extorquens CM4 plasmid pCMU01]
Sequence
MSEVTILLVDDHPIVREGYRRLLERQAGFRVVAEAETASEAYRLFRETAPSVVVMDLSLG
GPSGLEAIRNIRQWDGQARVLVFTMHQGSAFALKAFEAGAAGYVTKSSAPSEFVTAVTAV
AQGRRAVSADIAQEIAAERLAGKISPLNDLAPREVEILRLVASGLATETIAEALHLSPKT
VQNYHYGIKAKLGARNDAHLVWLAVSAGVLGTSFKVEP
Download sequence
Identical sequences B7L2Y9
440085.Mchl_5446 gi|218533310|ref|YP_002424125.1|NC_011758 WP_012606100.1.65134 gi|218533310|ref|YP_002424125.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]