SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|218534494|ref|YP_002401024.1|NC_011747 from NCBI plasmid sequences

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|218534494|ref|YP_002401024.1|NC_011747
Domain Number 1 Region: 8-143
Classification Level Classification E-value
Superfamily Enolase C-terminal domain-like 4.72e-57
Family Enolase 0.0000255
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|218534494|ref|YP_002401024.1|NC_011747
Sequence length 144
Comment putative enolase [Escherichia coli S88 plasmid pECOS88]
Sequence
MIFLPLTVAEDDWAGWKILHGALGEQIELVGDDLFVTNVKYIQRGIDENLANSALIKLNQ
IGSLSETFDAVQLCHDNNWGTFISHRSGETVDSFIADMTVAMRAGHLKTGAPCRGERIEK
YNQLMRIEDELGSSAQFAGKSAFK
Download sequence
Identical sequences A0A0E2KW87 A0A0G3KDM0 A0A140WYG6 A0A163Y7F7 A0A1X3K4G4 B7LI22 B9K6G3 D7XRC8 D8EEP4 E1IZ35 E1JEC3 E6BSW7 H9TJQ3 M1GIF4 Q573I5 Q6J5N5 V0SVA4 V0VL62 V0YWL6 V6FQM5 V8JZF2 W1F4Z7
585035.pECS88_0017 gi|378986400|ref|YP_005249556.1| gi|218534494|ref|YP_002401024.1| WP_000576767.1.2063 WP_000576767.1.24808 WP_000576767.1.56934 WP_000576767.1.84221 CP001122|CDS_85426-84992 gi|194446890|ref|YP_002038962.1|NC_011076 gi|218534494|ref|YP_002401024.1|NC_011747 gi|222104892|ref|YP_002539381.1|NC_011980 gi|410653234|ref|YP_006956522.1|NC_019117 gi|410653843|ref|YP_006957131.1|NC_019122 gi|451344633|ref|YP_007443265.1|NC_020271 gi|575670150|ref|YP_008998554.1|NC_023327

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]