SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|221635616|ref|YP_002523492.1|NC_011961 from NCBI plasmid sequences

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|221635616|ref|YP_002523492.1|NC_011961
Domain Number 1 Region: 465-650
Classification Level Classification E-value
Superfamily Methylesterase CheB, C-terminal domain 1.96e-50
Family Methylesterase CheB, C-terminal domain 0.0000267
Further Details:      
 
Domain Number 2 Region: 96-274
Classification Level Classification E-value
Superfamily S-adenosyl-L-methionine-dependent methyltransferases 8.01e-48
Family Chemotaxis receptor methyltransferase CheR, C-terminal domain 0.00039
Further Details:      
 
Weak hits

Sequence:  gi|221635616|ref|YP_002523492.1|NC_011961
Domain Number - Region: 303-356
Classification Level Classification E-value
Superfamily CheY-like 0.000384
Family CheY-related 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|221635616|ref|YP_002523492.1|NC_011961
Sequence length 657
Comment chemotaxis response regulator protein-glutamate methylesterase ofgroup 3 operon [Thermomicrobium roseum DSM 5159 plasmid unnamed]
Sequence
MRRGVMMEARSAETSGQAGARSRELGMVDQLIRQVGEKIFPCLGFSPTELLWQRLARVVH
QEARRVGAASVEEFLQRAVRGERAVLEAICQALTINETYFFREPKHFDALRQLLPELAKQ
QQPVRMLSAGCSSGEEPYSLAMTAHEVLGPLGNAFEVLGVDFDGEALERARGGCYRQWSF
RDQGLERARPHLEQRGELWCVRDVIRGRVRFEQVNLIERVPPGPFAVIFCRNTLMYFTSE
HRESIVRRFVEALLPGGILVIGSAETLDRIPAELERVTVAGAYLYRKREHVVPVAGTEPA
ETVRVLLVSSSPVSRVGIRQALRQLPGVELAGEVRSVEEARARLEDDGSAVVLLDALEDS
AVLERAALLQGWPLVAIVGPGVAVPRGLPSLVVSDLVPGAVRRLAPELGETLRQARVRPL
GRLRGEGNGTGLLLRRSVASGTLAGANGRTGTGALGEPLRRVAERLLLIGSSTGGPAVVA
DLIARLPAGLGLGVLVVQHMPPNFTRSFAERLSRVGRYAAREAEDGELVVADTVLVAPGG
RNVLLTRGGRVQVVPPDRSDIYVPNVNRAFASAARAGLAPRTMAVILTGMGDDGAIGMAE
LAAAGAYTVVQRPEEAVVAGMIEAALARGAVQKVLATADIPSEVVRWAQRGVMATRG
Download sequence
Identical sequences B9L346
309801.trd_A0210 WP_012642934.1.69661 gi|221635616|ref|YP_002523492.1|NC_011961 gi|221635616|ref|YP_002523492.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]