SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|223987649|ref|YP_002601102.1|NC_012104 from NCBI plasmid sequences

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|223987649|ref|YP_002601102.1|NC_012104
Domain Number 1 Region: 12-108
Classification Level Classification E-value
Superfamily Enzyme IIa from lactose specific PTS, IIa-lac 4.45e-26
Family Enzyme IIa from lactose specific PTS, IIa-lac 0.00071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|223987649|ref|YP_002601102.1|NC_012104
Sequence length 115
Comment PTS system, cellobiose-specific IIA component [Borrelia burgdorferi 64b plasmid 64b_cp26]
Sequence
MNKKIYSIEELIDKISMPVVAYSGEAKSFLREALEYAKNKEYDKAELTIQESKKSIAKAH
EVHREIIHQSATNPNSVKTPFILIHAEDHLMSAISELSIFEELINVYKIINEIKK
Download sequence
Identical sequences A0A0E0STP8
WP_012662308.1.86244 gi|223987649|ref|YP_002601102.1|NC_012104

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]