SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|224372017|ref|YP_002606182.1|NC_012109 from NCBI plasmid sequences

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|224372017|ref|YP_002606182.1|NC_012109
Domain Number 1 Region: 19-138
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.00000000000000768
Family N-terminal PAS domain of Pas kinase 0.095
Further Details:      
 
Domain Number 2 Region: 151-219
Classification Level Classification E-value
Superfamily Homodimeric domain of signal transducing histidine kinase 0.0000000294
Family Homodimeric domain of signal transducing histidine kinase 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|224372017|ref|YP_002606182.1|NC_012109
Sequence length 248
Comment predicted sensor protein ResE [Desulfobacterium autotrophicum HRM2 plasmid pHRM2a]
Sequence
MSDKLLQRIKELESELQRHQLSERQLEDSNDRLESLLYKLPLGIVIIDFETQKILDVNPL
ALSTFGCSLEELVGKKCTDYICPADKGRCPIIDQGLSLDRSEREVITFTGERIPVLKTVI
KDEIEGKVVLIECFTDITDKKRADEEHVKREKFQTVVEMAGAVCHEFNQPIQVINGYCGL
LIDDMEINVESKDQIEEILKAVSKMGLLTRDLMNITGYETKPYLNSKIVDIKRSSAKLNE
VEKKFVDR
Download sequence
Identical sequences C0QMM4
WP_012663313.1.52472 177437.HRM2_p00240 gi|224372017|ref|YP_002606182.1|NC_012109 gi|224372017|ref|YP_002606182.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]