SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|226357461|ref|YP_002787200.1|NC_012527 from NCBI plasmid sequences

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|226357461|ref|YP_002787200.1|NC_012527
Domain Number 1 Region: 4-188
Classification Level Classification E-value
Superfamily Methylesterase CheB, C-terminal domain 2.22e-56
Family Methylesterase CheB, C-terminal domain 0.0000486
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|226357461|ref|YP_002787200.1|NC_012527
Sequence length 346
Comment protein-glutamate methylesterase [Deinococcus deserti VCD115 plasmid 1]
Sequence
MTDFPLVVIGASAGGVSALMKLCAQLPSSFPAAVLVVQHVSPAHPSMLPRILSAAGTLHA
IHPRDGQTLHPGMIYVAPPDHHLLVDGETVLLSRGPRENRSRPAIDVLFRSAAVEAGSRV
IGVVLTGNLDDGTSGLHVIKQAGGLAVVQDPDDAEFASMPRSALNAVKVDHVAPLSELGA
LLASLVDDRARNHRPTPLASEDVRRLEVELGVAREEHALSKGVTRLGAPSPLTCPECHGT
LIEIREGTLVRFRCHSGHAYTAGTLLTEVSESVESKAYQALRALGETVILLRQLSDQRQK
QGDPAGAEAFLARAREVEASSEGIRALVRTTRALSVEKVERPDFDG
Download sequence
Identical sequences C1D207
WP_012694570.1.1337 gi|226357461|ref|YP_002787200.1|NC_012527 gi|226357461|ref|YP_002787200.1| 546414.Deide_1p00470

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]