SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|227818622|ref|YP_002822593.1|NC_012586 from NCBI plasmid sequences

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|227818622|ref|YP_002822593.1|NC_012586
Domain Number 1 Region: 157-342
Classification Level Classification E-value
Superfamily Methylesterase CheB, C-terminal domain 2.75e-61
Family Methylesterase CheB, C-terminal domain 0.0000238
Further Details:      
 
Domain Number 2 Region: 1-105
Classification Level Classification E-value
Superfamily CheY-like 0.00000000000952
Family CheY-related 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|227818622|ref|YP_002822593.1|NC_012586
Sequence length 348
Comment CheB, chemotaxis response regulator containing a CheY-like receiver domain and a methylesterase domain CheB [Sinorhizobium fredii NGR234 plasmid pNGR234b]
Sequence
MVRILLATSRVDLQELVERAVRSDASAELLGVARSFAEAVTMARQLSPDIVTMELRLGEH
DSVEAVREIMVSAPAPIVMVSRVEELGSVAARALDAGALAVIPAPPPVDGRLEKAATEKF
LSTIKAMAHVKVVRQWRKKSGGDGRNDQGDLAAAHAPIGIVGIAASTGGPAAIRSILMNV
SSKFPAPILIVQHMSSGFIDRVAASLDATVPLNVKVATDGERLRAGMVYLAPDGRQLGVS
GRSRIRVVNDAPVDGFKPSGSYLFGSIARAFKGEALAVILTGMGNDGTEGLRALREAGGK
AIAQDEESSVVFGMPKSAIGAGLVDFVLPLESIGGKIVALAEGRESGT
Download sequence
Identical sequences Q6W1R5
gi|227818622|ref|YP_002822593.1| gi|227818622|ref|YP_002822593.1|NC_012586 YP_002822593.1.63916 394.NGR_b03760

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]