SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|229587503|ref|YP_002860541.1|NC_012654 from NCBI plasmid sequences

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|229587503|ref|YP_002860541.1|NC_012654
Domain Number 1 Region: 47-108
Classification Level Classification E-value
Superfamily CheY-like 0.0000296
Family CheY-related 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|229587503|ref|YP_002860541.1|NC_012654
Sequence length 181
Comment hypothetical protein CLJ_0234 [Clostridium botulinum Ba4 str. 657 plasmid pCLJ]
Sequence
MNVAIMTGIDELNDQIQSKIKDSLISIYPKYLLENTVDIVIISPLIDMSTLNISFQDFLY
ELRKREIRIILLLGDKDSEYLGYALALGIYDIIFDPFNEEKIIKKLKYPTMFSEIAKLYL
NVSGQIKFKNDSNLINSEDINLKKQIINLFTLLGLNIQNTNQLSNRELLSILEKFIIEKI
L
Download sequence
Identical sequences gi|229587503|ref|YP_002860541.1| WP_012720287.1.34328 515621.CLJ_0234 gi|229587503|ref|YP_002860541.1|NC_012654

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]