SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|241113589|ref|YP_002973424.1|NC_012848 from NCBI plasmid sequences

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|241113589|ref|YP_002973424.1|NC_012848
Domain Number 1 Region: 2-262
Classification Level Classification E-value
Superfamily ClpP/crotonase 4.15e-85
Family Crotonase-like 0.0000152
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|241113589|ref|YP_002973424.1|NC_012848
Sequence length 267
Comment enoyl-CoA hydratase [Rhizobium leguminosarum bv. trifolii WSM1325 plasmid pR132501]
Sequence
MADTVLIDSRDGIATLTLNRPEKLNALNYALIDRLLAILDAIETDRSIRVVILTGSGERA
FSAGGDIYEFSESVAQGADVAMRDFVARGQRLTARLEAYHKPVIAAVNGLAFGGGCEITE
AVPLAIASERALFAKPEINLAMPPTFGGTQRLPRLAGRKRALELLLTGDAFSPQRALELG
LVNQLVPHDALMPAAHDLARRILRHSPLAAASILTAVTRGINQSIAEGLLIEGEQFARMA
PTADLREGLDAWIERRKPNYPGSWSLD
Download sequence
Identical sequences C6B5V5
WP_012755571.1.14669 gi|241113589|ref|YP_002973424.1| gi|241113589|ref|YP_002973424.1|NC_012848 395491.Rleg_5256

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]