SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|284172703|ref|YP_003406085.1|NC_013745 from NCBI plasmid sequences

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|284172703|ref|YP_003406085.1|NC_013745
Domain Number - Region: 11-55
Classification Level Classification E-value
Superfamily Methylesterase CheB, C-terminal domain 0.0144
Family Methylesterase CheB, C-terminal domain 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|284172703|ref|YP_003406085.1|NC_013745
Sequence length 59
Comment hypothetical protein Htur_4626 [Haloterrigena turkmenica DSM 5511 plasmid pHTUR02]
Sequence
MDVGNDPTLATSSHIVIAKRYERCIEDSLPDEAERIENAPTLMRQKQIAKEIAKEHFNS
Download sequence
Identical sequences D2S215
gi|284172703|ref|YP_003406085.1| gi|284172703|ref|YP_003406085.1|NC_013745 WP_012945656.1.92728

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]