SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|288960011|ref|YP_003450351.1|NC_013855 from NCBI plasmid sequences

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|288960011|ref|YP_003450351.1|NC_013855
Domain Number 1 Region: 65-200
Classification Level Classification E-value
Superfamily ClpP/crotonase 0.0000000000000537
Family Clp protease, ClpP subunit 0.009
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|288960011|ref|YP_003450351.1|NC_013855
Sequence length 231
Comment hypothetical protein AZL_a02760 [Azospirillum sp. B510 plasmid pAB510a]
Sequence
MSVRTLMRKIGFGCGLGALLIAGAAIGHAATQPDGLSFSPAPTLPAAAAPASPDFPDAAL
SRNDQDDLTILRLDGIITPGAERGFVDALHALPARRPLVIELSSPGGFTAAGYRMIDAVL
AERQSGRPVATRVRDGESCESMCVGLYLAGYPRYAAPRAEFMVHAPRMAENGRMTMRSTQ
MMVDRLVSLGASPGWIRRVTAEGGFSGAHDHRETADRLSADGANIVTDLLR
Download sequence
Identical sequences D3NZH8
gi|288960011|ref|YP_003450351.1| gi|288960011|ref|YP_003450351.1|NC_013855 WP_012975703.1.27297

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]