SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|288960046|ref|YP_003450386.1|NC_013855 from NCBI plasmid sequences

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|288960046|ref|YP_003450386.1|NC_013855
Domain Number 1 Region: 181-366
Classification Level Classification E-value
Superfamily Methylesterase CheB, C-terminal domain 5.89e-56
Family Methylesterase CheB, C-terminal domain 0.0000226
Further Details:      
 
Domain Number 2 Region: 23-131
Classification Level Classification E-value
Superfamily CheY-like 1.2e-26
Family CheY-related 0.0078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|288960046|ref|YP_003450386.1|NC_013855
Sequence length 371
Comment protein-glutamate methylesterase, two-component response regulator [Azospirillum sp. B510 plasmid pAB510a]
Sequence
MNGAANGGTAGEAAGGATGGARRIRVLVVEDSPVIQQLLSHVIGADPRLEVAGIASSGEQ
ALRMIERTAPDVVSLDIRLPGIDGFEVTSRIMRQTPLPIVVVASDVRDLDIPMRALQAGA
LAVVEKPGSMARADYQTVARHLCTQLVIMSQVKVIRHRIGARAAARPAVPDGPAQGGGMR
RFRALGLVASTGGPAALARILKELPAAFPLPVFVVQHMGAPFMEGFANWLGTVSPLPVRL
GEAGASPRPGTVHVAPGDRHMLVEGGIIRLSGDPLVCGQRPSGDVLFRSMAQAYGAAGIG
VLLTGMGEDGGRGLVEMHRTGAYTIAEHASTAVIHSMPGTAVRLGGVLEELPLDRLAGRL
LHLTSDQKMAS
Download sequence
Identical sequences D3NZL3
gi|288960046|ref|YP_003450386.1| WP_012975738.1.27297 gi|288960046|ref|YP_003450386.1|NC_013855

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]