SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|288962377|ref|YP_003452672.1|NC_013858 from NCBI plasmid sequences

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|288962377|ref|YP_003452672.1|NC_013858
Domain Number 1 Region: 196-385
Classification Level Classification E-value
Superfamily Methylesterase CheB, C-terminal domain 2.22e-61
Family Methylesterase CheB, C-terminal domain 0.0000196
Further Details:      
 
Domain Number 2 Region: 19-132
Classification Level Classification E-value
Superfamily CheY-like 4.13e-27
Family CheY-related 0.00073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|288962377|ref|YP_003452672.1|NC_013858
Sequence length 388
Comment protein-glutamate methylesterase, two-component response regulator, chemotaxis [Azospirillum sp. B510 plasmid pAB510d]
Sequence
MSDSLGRGPLTTARPANPDPVRVMVVDDSAVIRGLLTRALEGDPEIRVVTSVGDGQMAVS
SLQRNSIDVIVLDIEMPVMDGLTAIPKLLAVAPQVKIIMASTLTLRGADVSLRCLSAGAA
DYIPKPTSTREIGGAEDFKRELVAKVKALGAAARRAGSRSRGEIRPLTPASPIGLLKREV
GPIVTRPTPAGAIATKPDVIAIGSSTGGPQALFEVLSHLKAGVSQPILITQHMPATFTTI
LAEHITRQCGIDAREAKDGEPIVQNRCYIAPGDFHMLVAQRAGANVITLSKDPPENFCRP
AVDPMMRSILKAFGGRKILACILTGMGQDGLKGCTDVVNGGGTLIAQDEASSVVWGMPGA
VAQAGICNAILPLKEIGPHIRKLASRAA
Download sequence
Identical sequences D3P649
gi|288962377|ref|YP_003452672.1| gi|288962377|ref|YP_003452672.1|NC_013858 WP_012977934.1.27297

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]