SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|288962653|ref|YP_003452947.1|NC_013859 from NCBI plasmid sequences

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|288962653|ref|YP_003452947.1|NC_013859
Domain Number 1 Region: 30-215
Classification Level Classification E-value
Superfamily Methylesterase CheB, C-terminal domain 5.62e-50
Family Methylesterase CheB, C-terminal domain 0.00025
Further Details:      
 
Domain Number 2 Region: 297-490
Classification Level Classification E-value
Superfamily S-adenosyl-L-methionine-dependent methyltransferases 4.43e-46
Family Chemotaxis receptor methyltransferase CheR, C-terminal domain 0.00043
Further Details:      
 
Domain Number 3 Region: 1232-1400
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 4.58e-39
Family Histidine kinase 0.004
Further Details:      
 
Domain Number 4 Region: 1416-1535
Classification Level Classification E-value
Superfamily CheY-like 8.25e-24
Family CheY-related 0.0033
Further Details:      
 
Domain Number 5 Region: 883-1033
Classification Level Classification E-value
Superfamily GAF domain-like 0.0000000000000198
Family GAF domain 0.022
Further Details:      
 
Domain Number 6 Region: 1163-1243
Classification Level Classification E-value
Superfamily Homodimeric domain of signal transducing histidine kinase 0.00000000000608
Family Homodimeric domain of signal transducing histidine kinase 0.005
Further Details:      
 
Domain Number 7 Region: 226-298
Classification Level Classification E-value
Superfamily Chemotaxis receptor methyltransferase CheR, N-terminal domain 0.0000000929
Family Chemotaxis receptor methyltransferase CheR, N-terminal domain 0.02
Further Details:      
 
Domain Number 8 Region: 729-849
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.0000314
Family BphP N-terminal domain-like 0.077
Further Details:      
 
Weak hits

Sequence:  gi|288962653|ref|YP_003452947.1|NC_013859
Domain Number - Region: 1027-1114
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.000389
Family Heme-binding PAS domain 0.062
Further Details:      
 
Domain Number - Region: 661-748
Classification Level Classification E-value
Superfamily Methyl-accepting chemotaxis protein (MCP) signaling domain 0.0034
Family Methyl-accepting chemotaxis protein (MCP) signaling domain 0.0056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|288962653|ref|YP_003452947.1|NC_013859
Sequence length 1544
Comment two-component hybrid sensor and regulator modulated chemotaxis protein methyltransferase [Azospirillum sp. B510 plasmid pAB510e]
Sequence
MMSADEGTDRHCQDIPRMDQDEQQRIRPGPLAIVGIGASAGGLKAITALLRAIPADSGLT
FVVIQHRIPNNERLLADLLKNVTVLSVHTAHDGIPLEADHIYIAPAGRLPTMEAGQLRIR
ESQQSVDATLPIDIFFRTLATDQQEKAICVVLSGTGADGTNGLRSIKECGGLVVVQDPTT
ADFDDMPGSAIATGMADYILPPERMPGAIVDFVHQPYIGPATAQKTDAPDGALDGILDLL
SAHTKRDHKAYKPRSLTRRIERRMGIHHIADMTEYRAFLGTHPAEIELLSRDILISVTRF
FRDGPAFDILAGEYIVPLVRNQPAGKPIRVWVPACATGEEAYSIAILLMEACTRCGVSPG
FRVFATDVDNRALTVARTGLYPETITVDVSVERLARFFTKAEDGYKVAKPLRDVVSFSQH
DLLSDPPFSKLDLISCRNMLIYIEPDVQKAIFALFHFALLDNGGLFLGTAENLDTLSDLF
APLSKKWRLYRKIGTTRSSAMAVPLTGGRSAVPVPALPTPLRGTSPADIIRQALLLEYAP
AAVLIDGLHRIQYLFGPTGDFLDLPTGEPPWDLTAMARGELRLQLRRAVAQALAVHGRVQ
ISGIRHKRHGVVVPVTVLVIPVRFPRTGSDLLLVTFTADHAVPSTPVAETAPLPMEIDGV
EQLENELRMTREELNDTIEELSATSEALRVANEEILSIGEESQSTTEELETSKEELQSLN
EELSTLNSQLHEKVDELEATTNDLGNLLSSTDIATVFLSSDLRIKRFTPSATRLFALLPQ
DAGRLITDIARHFSDPCLLPDIRSVLSSLMPSEREVSTDDDATFLRRIQPYRTQQGRGEG
VVITFSDVTPLKRTSLAMALQARQYKLIADLGRKDLIGAEGSETLTEAARLIAEGLGADG
VAILGPSEDPSGRRTGDADDLVLLGSAGLSVPQEPAVQIPSDMSTLVGRVFRSRQPSIVE
DFATDQRVRSSMALSGSNFVSGLSVPFGAAARGPSILAVLSRKAGRFNDADLEFVQAIAS
VLGLVIERAGVLRTARAERDFAQAIVDTVREPLLVLDEMLRVVGASAAFHQSFATTPDGV
LGIQLAETAGGLLADPELRRALERIVPDGTVIDALELTIGQGVGDQGAEGRRTLLLNARR
LNQAGGLILLAMEDVTEQVRVREALAAAKAAAELASASKTRFLAAASHDLRQPVQALLMF
HHLVAMQPQGEAAAKLLVSMGNALGAMTAMLDDILDVSRLDAGIIHVTLRSCPVQTVIDS
LCAELSPLAEAAELTLHSVRTSLSVRSDPKLLERILRNFIANAIKYTDQGRILVGCRRAG
PNLRIQVWDTGRGIPPNQLASIFEEFHQVDNPERDRRQGLGLGLSIVDRLAALLHHPIRV
KSAPGRGSVFEILVPLASPDDSLPKDEEMAVSDGGNGERVVVIDDDPTVLDGVAAFLHEL
GYDVVAASDGDTAVERLGNGVPDLVIADFRLKGTETGSEAIRRLERHFAARLPGILLTGD
TSPARIREASASGFLLLHKPLSPEPLLTAIRHALTDRSVEPGTA
Download sequence
Identical sequences D3P6X4
gi|288962653|ref|YP_003452947.1| gi|288962653|ref|YP_003452947.1|NC_013859 WP_012978201.1.27297

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]