SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|296137698|ref|YP_003644942.1|NC_014157 from NCBI plasmid sequences

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|296137698|ref|YP_003644942.1|NC_014157
Domain Number 1 Region: 73-257
Classification Level Classification E-value
Superfamily Methylesterase CheB, C-terminal domain 1.29e-50
Family Methylesterase CheB, C-terminal domain 0.00025
Further Details:      
 
Domain Number 2 Region: 342-531
Classification Level Classification E-value
Superfamily S-adenosyl-L-methionine-dependent methyltransferases 1.48e-46
Family Chemotaxis receptor methyltransferase CheR, C-terminal domain 0.00024
Further Details:      
 
Domain Number 3 Region: 896-1021
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 2.74e-21
Family Heme-binding PAS domain 0.025
Further Details:      
 
Domain Number 4 Region: 1159-1256
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 0.00000000000000629
Family Histidine kinase 0.025
Further Details:      
 
Domain Number 5 Region: 269-343
Classification Level Classification E-value
Superfamily Chemotaxis receptor methyltransferase CheR, N-terminal domain 0.0000000000000353
Family Chemotaxis receptor methyltransferase CheR, N-terminal domain 0.0063
Further Details:      
 
Domain Number 6 Region: 783-898
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.0000000391
Family Heme-binding PAS domain 0.09
Further Details:      
 
Weak hits

Sequence:  gi|296137698|ref|YP_003644942.1|NC_014157
Domain Number - Region: 707-799
Classification Level Classification E-value
Superfamily Tropomyosin 0.00101
Family Tropomyosin 0.0068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|296137698|ref|YP_003644942.1|NC_014157
Sequence length 1257
Comment protein-glutamate methylesterase CheB [Salinibacter ruber M8 plasmid pSR84]
Sequence
MSLDSPEDPPLDASEDSSEGSSDDSLEDSPRDVSGRSSEGAPAGDAPAEDAPAEDAPARL
FAFQPAPEDGGQEFPVVGIGASAGGVGALRRFFRNLPDEVGMAFVVVLHLSPDHESNLTE
ILQHETDLPVQVATDECPLEADHIYVIPPQHEIQVEASMLRLSDRSSDHRPDTIDALLGS
LAAAYKRQAIGIILSGTGADGTLGLRSIKSHGGIAMVQQPGDAEHEDMPRSALDTGVIDL
VAPADELAERLVAYHENARTIQLPESEEELPADEQTTLQKIFTELQGRTGHDFSHYKRST
VLRRLERRLQVTDVETLSAYLQVLNDQPGEARALYKELLISVTRFFRTPEAFETLEDSVI
PSLFEDKAPDEEVRVWVSGCATGEEAYSLAILLHEYARALEAPPSIQVFATDVDTEGLAT
ARAGVYPPTIAADVSEARLDRFFRRENDQYRVTPSLRNSVVFAEHDLTQDPPFSNLDLVC
CRNLLIYLDQTLQEYVFRLFHYALNENGFLFLGPSEAIGPAQSFFAVVDETRSILKVKSP
ASDEDRPVPLFPPSNTSSPDPTPQTPTRTPSDDMETVHQRLLMDQMASLLVNENREIVHL
TGEAGQFLRHKPGTPTHNLLEKVPPTLRLELRGALYQAFQKDQTTERTLPFPAPEGPEHV
RVRVQPVDSPNVDRRLAQVCFENVERVDLDGMEGDAPDTSPSTEVTERERDLEDELQDIK
EQLQITSEEYETVTEEMETANEELMSMNEELQAKNEELQTSKEQLQSVNEELTTTNQQLS
AKVEALDQANNDLQNLMETTEVATLFLGRDLEIRRYTPPVTEVFSLRESDIGRPITDFTP
KIRYDALVEDAERVLAEQTAIEHEVEGPGRTWYLMRLRPYRTMVDEVEGVVVTFVDITAQ
KHAARTLRAERDLVSALIDTAGALIVVLGEDGAIVRFNTACERLTGYDAAEAEGTDLRDL
LVAPDDRDAVTARLDALADGTIDRADLEMRWTPAEGDPRLIKGSFTALRDESGDVKHFIV
TGTDMTRHRELEREVIEVSNRERQRIGEALHDVVSSGLTNAAMRAETLAYDLREKSDLKE
KSEEGPEEDLEQEATVEAEDLQKIFSKVKEAGDQIRSLSHALIPRALRQDHLAAALADLA
DEEEDFSDVECVFVGDETETRPEDETDAMNLYRIAHEAVANAREHADPSRIQLGLREEGS
GLVLSIRDDGRGWDGETPDDEGLGLHLMRYRANLIGATLTLSSGDGQTVVECRLPLP
Download sequence
Identical sequences D6CVZ6
gi|296137698|ref|YP_003644942.1|NC_014157 WP_013124660.1.91540 gi|296137698|ref|YP_003644942.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]