SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|300693556|ref|YP_003749529.1|NC_014310 from NCBI plasmid sequences

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|300693556|ref|YP_003749529.1|NC_014310
Domain Number 1 Region: 177-356
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 1.31e-36
Family Histidine kinase 0.0092
Further Details:      
 
Domain Number 2 Region: 107-187
Classification Level Classification E-value
Superfamily Homodimeric domain of signal transducing histidine kinase 5.3e-16
Family Homodimeric domain of signal transducing histidine kinase 0.0029
Further Details:      
 
Domain Number 3 Region: 69-120
Classification Level Classification E-value
Superfamily HAMP domain-like 0.00000235
Family HAMP domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|300693556|ref|YP_003749529.1|NC_014310
Sequence length 363
Comment sensory histidine kinase in two-component regulatory system with CpxR [Ralstonia solanacearum PSI07 plasmid mpPSI07]
Sequence
MSLRLGRLFWRGFVMLWLAMVAAFACAGLYMHASGHKPPSPGAMPWILLVPVLSGATVAL
PVAFGLAWHLSKPLRHLTQALRDAARARFDVRVLPALGSRRDEFTDLAREFDNMAARLQQ
ASMQQRQLFHDVSHELRSPLARIQAAIGLMQQDPQSSPAMAERVAREAQRLDQLIEELLT
LHKLEAGAMSPARERVDVIELLADIVQDAAFEAQARGCAVTLDAPGSFVAEVAGEPLYRA
LENVVRNAVKYTAAHTAVEVHARTLEPLQAGSDRAEWLEIRVSDRGPGVPAESCEDIFEP
FRRLEPPQRDAAAQSVPGVGLGLAIARRAMALHGGDIRAAPREGGGLVVSVCLPRLALRS
TQL
Download sequence
Identical sequences D8MZV0
gi|300693556|ref|YP_003749529.1|NC_014310 WP_013209616.1.29177 gi|300693556|ref|YP_003749529.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]