SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|300694206|ref|YP_003750179.1|NC_014310 from NCBI plasmid sequences

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|300694206|ref|YP_003750179.1|NC_014310
Domain Number 1 Region: 2-127
Classification Level Classification E-value
Superfamily CheY-like 3.42e-41
Family CheY-related 0.00011
Further Details:      
 
Domain Number 2 Region: 132-232
Classification Level Classification E-value
Superfamily C-terminal effector domain of the bipartite response regulators 6.8e-25
Family PhoB-like 0.0002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|300694206|ref|YP_003750179.1|NC_014310
Sequence length 245
Comment Transcriptional regulatory protein ompR [Ralstonia solanacearum PSI07 plasmid mpPSI07]
Sequence
MSGTKILVVDDDVELRDLLREYLSQQGFAVSVLHDGDGLAARLERERPALVVLDLMMPKV
DGLSALRDLRARNDDVPVILLTARSDEIDRIIGLEIGADDYLGKPFSPRELLARINAVLR
RRQAVAPAAPEDRDSFSFGPFKLNFRMRTLFRGDHALSISDTEFALLKLLITHAMQVLTR
EHIVELMYGPGSSVSDRGIDVQVWRLRRVLDEDAQRPRYIQTVRGRGYTFVPDERDPHDE
VQSPV
Download sequence
Identical sequences A0A1U9VLE6 D8N1P7 G2ZS10
gi|300694206|ref|YP_003750179.1|NC_014310 WP_013210263.1.13478 WP_013210263.1.29177 gi|300694206|ref|YP_003750179.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]