SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|300694364|ref|YP_003750337.1|NC_014310 from NCBI plasmid sequences

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|300694364|ref|YP_003750337.1|NC_014310
Domain Number 1 Region: 184-372
Classification Level Classification E-value
Superfamily Methylesterase CheB, C-terminal domain 1.15e-72
Family Methylesterase CheB, C-terminal domain 0.000000249
Further Details:      
 
Domain Number 2 Region: 6-111
Classification Level Classification E-value
Superfamily CheY-like 5.27e-27
Family CheY-related 0.0000091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|300694364|ref|YP_003750337.1|NC_014310
Sequence length 380
Comment chemotactic response regulator; methylesterase, in two-component regulatory system with CheA [Ralstonia solanacearum PSI07 plasmid mpPSI07]
Sequence
MNDKRKIQVLCIDDSALIRSILKEIINAQPDMEVVGVAPDPIIARDLIKQTNPDVLTLDV
EMPKMDGLDFLEKLMRLRPTPVVMISSLTERGSEATLRALELGAVDFVAKPKLGMRDGMN
EYADQIADKIRAAARARLRPRTASPAPAPAVASPAHATHAAHARPESGAVAAAAPAPART
HFSSTEKLIIVGASTGGTEAIKDFLLEMPPDCPGILIVQHMPAGFTTSFAKRLDSLCRIR
VKEAVHGERVLPGHAYIAPGDMHLSLGRSGANYVTELDQGPPVNRHRPAVDVLFRSAARN
AGANALGVILTGMGKDGAAGMLEMRNAGAYNVAQDEASCVVYGMPKEAVAHGGVHEILPL
HQIGPHVLAKLSAHGRVTRV
Download sequence
Identical sequences D8N253
WP_013210420.1.29177 gi|300694364|ref|YP_003750337.1|NC_014310 gi|300694364|ref|YP_003750337.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]