SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|300697980|ref|YP_003748641.1|NC_014309 from NCBI plasmid sequences

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|300697980|ref|YP_003748641.1|NC_014309
Domain Number 1 Region: 182-370
Classification Level Classification E-value
Superfamily Methylesterase CheB, C-terminal domain 2.48e-72
Family Methylesterase CheB, C-terminal domain 0.000000279
Further Details:      
 
Domain Number 2 Region: 6-111
Classification Level Classification E-value
Superfamily CheY-like 3.42e-27
Family CheY-related 0.00000887
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|300697980|ref|YP_003748641.1|NC_014309
Sequence length 378
Comment chemotactic response regulator; methylesterase, in two-component regulatory system with CheA [Ralstonia solanacearum CFBP2957 plasmid RCFBPv3_mp]
Sequence
MTDKRKIQVLCIDDSALIRSILKEIINAQPDMEVVGTAPDPIIARDLIKQTNPDVLTLDV
EMPKMDGLDFLEKLMRLRPTPVVMISSLTERGSEATLRALELGAVDFVAKPKLGMRDGMN
EYADQIADKIRAAARARLRPRTAAPAAAAPAHAAHAAHAVHARPEHGVAAAAPAPARTHF
SSTEKLIIVGASTGGTEAIKDFLLEMPPDCPGILIVQHMPAGFTTSFAKRLDGLCRIRVK
EAVHGERVLPGHAYIAPGDMHLSLGRSGANYVTELDQNPPVNRHRPAVDVLFRSAARNAG
ANAIGVILTGMGKDGAAGMLEMRNAGAYNVAQDEASCVVYGMPKEAVAHGGVHDILPLHQ
IGPHVLAKLSAHGRVTRV
Download sequence
Identical sequences D8P5S5
gi|300697980|ref|YP_003748641.1| gi|300697980|ref|YP_003748641.1|NC_014309 WP_013208741.1.77028 WP_013208741.1.85682

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]