SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|307592296|ref|YP_003899887.1|NC_014533 from NCBI plasmid sequences

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|307592296|ref|YP_003899887.1|NC_014533
Domain Number 1 Region: 10-195
Classification Level Classification E-value
Superfamily Methylesterase CheB, C-terminal domain 1.28e-60
Family Methylesterase CheB, C-terminal domain 0.0000454
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|307592296|ref|YP_003899887.1|NC_014533
Sequence length 202
Comment CheB methylesterase [Cyanothece sp. PCC 7822 plasmid Cy782201]
Sequence
MLSHFPFVAYNVIGIAASLGGLSAISKILGALPENFPAAIVIVQHIAPQYPSYLCEILSQ
RTALRVKQAEHGELLRPGTVYTPVPDRHLLINPDGTFYLSDSEKMNFVRPCADKMFMSLA
KTYKTRTIAIVLTGRDSDGALGVLAIKKYGGVVIAQDEATSECFSMPKSAIDTGKVDLVL
PINAISAALVNLLNTKIELHTT
Download sequence
Identical sequences E0ULJ1
gi|307592296|ref|YP_003899887.1| gi|307592296|ref|YP_003899887.1|NC_014533 WP_013334571.1.91546

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]