SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|310639278|ref|YP_003944037.1|NC_014621 from NCBI plasmid sequences

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|310639278|ref|YP_003944037.1|NC_014621
Domain Number 1 Region: 280-474
Classification Level Classification E-value
Superfamily S-adenosyl-L-methionine-dependent methyltransferases 5.01e-51
Family Chemotaxis receptor methyltransferase CheR, C-terminal domain 0.0005
Further Details:      
 
Domain Number 2 Region: 6-189
Classification Level Classification E-value
Superfamily Methylesterase CheB, C-terminal domain 5.62e-38
Family Methylesterase CheB, C-terminal domain 0.00086
Further Details:      
 
Domain Number 3 Region: 720-836
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.0000000000128
Family Heme-binding PAS domain 0.086
Further Details:      
 
Domain Number 4 Region: 215-283
Classification Level Classification E-value
Superfamily Chemotaxis receptor methyltransferase CheR, N-terminal domain 0.000000000144
Family Chemotaxis receptor methyltransferase CheR, N-terminal domain 0.01
Further Details:      
 
Weak hits

Sequence:  gi|310639278|ref|YP_003944037.1|NC_014621
Domain Number - Region: 923-1030
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 0.000354
Family Histidine kinase 0.032
Further Details:      
 
Domain Number - Region: 636-729
Classification Level Classification E-value
Superfamily Tropomyosin 0.00575
Family Tropomyosin 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|310639278|ref|YP_003944037.1|NC_014621
Sequence length 1040
Comment PAS/PAC sensor protein [Ketogulonicigenium vulgare Y25 plasmid pYP1]
Sequence
MLRLSDRFPIVSIGCAQSALPALETFFETLEPNPGFAIVIVMHLEELRDSDVCDAIAGWT
GMPVAVAAADTPVASNTVYIMPADAILTIEDGVLRSNAPDMAKRERKPVDVFFADLAQDQ
REYAVGVILSGGNADGTLGAKAIREAGGLTLAQSLDDDEALNPDMPQSAISINIIDLAIP
VEEIPDRLRIFARSFDTLEAVSRASDELTRTDLQRAHREICAILAGHSTHDFSGYKTKTF
FRRVRRRMQVQQSETLDNYIDLLRKDPTEVTNLFRDLLINVTSFFRDEDAFKLLEKEIIP
KLFEHKKSSDTLRIWVPGCATGEEVYSIAILMREFIERHPNAPRVQIFATDIDEAALSVA
RAGRYPEALLDGLSAERRRRYVRPDGASFVIINEVREMCVFSPHSLVRDPPFSRMDMVSC
RNLLIYFGPEVQRDVIPVFHYSLRPRGYLFLGSSESIGKHSHLFSTLDKKHRIFQARDHS
PKALRLTSNVSHNRSFLFTDASASSQKERDTSLRSKVESRILERFAPAHVVVNSDADIVY
YSAGTSPFLEAPQGVPSRQLMTLARKGLRLDLRAALSECVSTQKRVTRQNLLAERESDEV
QIVDFTIEPISDRAGAEQLYLVVFEAKSPPSAQALGGQYSLSDDRHTELEHELRDTKERL
QSTIEEYETALEELKSSNEELVSVNEEVQSSNEELEASKEEMQSLNEELNTINSELNGKI
EELDRANNDLRNLFESTRIATIFLDRGLVIRTFTPEAAQFFNLRTNDVGRPLTELSSQLD
YPSLSEDIRAVFASGDALDHHVAKDRDGQQYLVRVIPYRTDGNEIDGVIVTFVDVTQLAE
AEHMQHVLVEELNHRVKNLLLVVGSIAKRTIEKSQSVSTFERAFSGRLAALSRAYGSLSR
DQWVDSSIADIFTAELAPFGHSAFHIEGPDLSLPVQIGLSLTMVAHELTTNAAKYGALSV
DAGLVKVQWQFENSQLTIDWSETGGPGAKEPSENGFGFELLEGEISYRLSGEIKKVYEKT
GFRATITIPLSPYATEKSKF
Download sequence
Identical sequences E3F4V4 F9YAX2
WP_013368451.1.38423 WP_013368451.1.51946 WP_013368451.1.57483 WP_013368451.1.60947 YP_005796735.1.93432 gi|310639278|ref|YP_003944037.1|NC_014621 gi|385235395|ref|YP_005796735.1|NC_017386 gi|310639278|ref|YP_003944037.1| gi|385235395|ref|YP_005796735.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]