SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|317053149|ref|YP_004119503.1|NC_014841 from NCBI plasmid sequences

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|317053149|ref|YP_004119503.1|NC_014841
Domain Number 1 Region: 2-100
Classification Level Classification E-value
Superfamily Enzyme IIa from lactose specific PTS, IIa-lac 7.19e-34
Family Enzyme IIa from lactose specific PTS, IIa-lac 0.00036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|317053149|ref|YP_004119503.1|NC_014841
Sequence length 100
Comment phosphotransferase system PTS lactose/cellobiose-specific IIA subunit [Pantoea sp. At-9b plasmid pPAT9B04]
Sequence
MIDLEDAVMEIIVNSGQARSLCFEALQAAREGDITQAQQLLQQSDTYSRQAHKMQTRLIE
QDAGEGRQPMTLIMVHAQDHLMTSLLARELSAEIVHLYQR
Download sequence
Identical sequences E6WNG2
WP_013512771.1.99583 gi|317053149|ref|YP_004119503.1| gi|317053149|ref|YP_004119503.1|NC_014841

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]