SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|319778163|ref|YP_004134593.1|NC_014918 from NCBI plasmid sequences

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|319778163|ref|YP_004134593.1|NC_014918
Domain Number 1 Region: 150-337
Classification Level Classification E-value
Superfamily Methylesterase CheB, C-terminal domain 1.31e-58
Family Methylesterase CheB, C-terminal domain 0.0000561
Further Details:      
 
Domain Number 2 Region: 1-101
Classification Level Classification E-value
Superfamily CheY-like 4.13e-20
Family CheY-related 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|319778163|ref|YP_004134593.1|NC_014918
Sequence length 339
Comment cheb methylesterase [Mesorhizobium ciceri biovar biserrulae WSM1271 plasmid pMESCI01]
Sequence
MRIGVVNDMPMAVELLRRLVLSTGEHQVAWVATNGREAVEVCRRDLPDLILMDLAMPEMD
GVEATRRIMAETPCSILLVTASIEANLAGVYEAMGHGALDAVDIPSVGIEGNASSQSARL
LTNKIATIGKLIGDAPAKTKRRMSRDAEPTPRRLIAIGASAGGPAAVAAVLSAFPVDFDG
AIVLVQHLDAQFVPGLTDWLGQHTPLPIRPAREKDSPQAGTVLVASSADHLVFKSAQQLG
YTPSPKDNVYRPSVDVFFESAAQWWPGSVIGVLLTGMGRDGARGLRQLRDKGHLTIAQDR
ATSAVYGMPKAAADIGAAVDILPLSAIGSRIIEACERST
Download sequence
Identical sequences E8TNZ0
WP_013525364.1.92525 YP_004134593.1.54699 gi|319778163|ref|YP_004134593.1|NC_014918 gi|319778163|ref|YP_004134593.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]