SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|325284496|ref|YP_004257035.1|NC_015163 from NCBI plasmid sequences

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|325284496|ref|YP_004257035.1|NC_015163
Domain Number 1 Region: 1-123
Classification Level Classification E-value
Superfamily CheY-like 4.27e-38
Family CheY-related 0.00016
Further Details:      
 
Domain Number 2 Region: 122-219
Classification Level Classification E-value
Superfamily C-terminal effector domain of the bipartite response regulators 7.09e-30
Family PhoB-like 0.00053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|325284496|ref|YP_004257035.1|NC_015163
Sequence length 221
Comment two component transcriptional regulator, winged helix family [Deinococcus proteolyticus MRP plasmid pDEIPR04]
Sequence
MPNILIVDDDPAILEILRAYLKAEGHTVLEACDGYSAREQLPRADLAILDWMLPGVSGVD
LAREARASGLTLPILMLTARGEEEDKLRGLDFGVDDYVVKPFSPREVVARVRALLRRVGV
QEEIAVGDLRIDLRGHSASLSGERLELSKLEFDLLSALAQHPGMAWPRERLLERVWGSDF
PGTERVVDVHITGLRKKLGDTSDTPRFIETVRGVGYRFREE
Download sequence
Identical sequences F0RR72
WP_013616025.1.72503 WP_013616025.1.73314 WP_013616025.1.93574 gi|325284496|ref|YP_004257035.1| gi|325284496|ref|YP_004257035.1|NC_015163

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]