SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|343126951|ref|YP_004770326.1|NC_015907 from NCBI plasmid sequences

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|343126951|ref|YP_004770326.1|NC_015907
Domain Number 1 Region: 12-108
Classification Level Classification E-value
Superfamily Enzyme IIa from lactose specific PTS, IIa-lac 1.83e-25
Family Enzyme IIa from lactose specific PTS, IIa-lac 0.00063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|343126951|ref|YP_004770326.1|NC_015907
Sequence length 115
Comment PTS system lactose/cellobiose-specific transporter IIA subunit [Borrelia bissettii DN127 plasmid cp26]
Sequence
MTKKTYSIEELIDKISMPVVAYSGEAKSFLREALEYAKNKEYDKAELAIQESKKSIAKAH
EAHREIIHQSATNPNSVKAPFILIHAEDHLMSAISESSIFEELINVYKIINEIKN
Download sequence
Identical sequences A0A1L8ZAG7 G0AMT6
gi|343126951|ref|YP_004770326.1| gi|343126951|ref|YP_004770326.1|NC_015907 WP_014017650.1.90944 WP_014017650.1.9618

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]