SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|374293722|ref|YP_005040745.1|NC_016623 from NCBI plasmid sequences

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|374293722|ref|YP_005040745.1|NC_016623
Domain Number 1 Region: 4-187
Classification Level Classification E-value
Superfamily Methylesterase CheB, C-terminal domain 6.28e-54
Family Methylesterase CheB, C-terminal domain 0.0000929
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|374293722|ref|YP_005040745.1|NC_016623
Sequence length 337
Comment putative Chemotaxis glutamate methylesterase CheB-like [Azospirillum lipoferum 4B plasmid AZO_p3]
Sequence
MDKRDILAIGASAGGLPALQRLFGGMPKGFTPTVFVVVHISPTAHSVLPLLLDRVGWLPA
FHPADEEPIRPGHIHVASPDHHLLVHRDRVLIRRGPRENRTRPAVDPLFRSAGVAFGSRV
IGIVLSGALDDGASGLRAIRRCGGIGIAQDPAEAEWPGMPRSAIERGEVDHVLTLDAMPA
LLTRLSAEPAPPSPPTPQDIATEARIAEQEFTTVSDDTQAVAKPTTLSCPECGGGLSEIH
DGAALRFRCQVGHAYSPDSMEEAQAEAMEKALWVALRTHEDRVELFRRLANHATERGRNQ
LATGWNRQMQEARKNSELLRSVLTKPDVKRTGEQKKG
Download sequence
Identical sequences G7ZEE0
gi|374293722|ref|YP_005040745.1| WP_014249508.1.44154 gi|374293722|ref|YP_005040745.1|NC_016623

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]