SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|374293802|ref|YP_005040825.1|NC_016623 from NCBI plasmid sequences

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|374293802|ref|YP_005040825.1|NC_016623
Domain Number 1 Region: 2-116
Classification Level Classification E-value
Superfamily CheY-like 1.71e-32
Family CheY-related 0.00054
Further Details:      
 
Domain Number 2 Region: 142-233
Classification Level Classification E-value
Superfamily C-terminal effector domain of the bipartite response regulators 0.0000000000000015
Family PhoB-like 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|374293802|ref|YP_005040825.1|NC_016623
Sequence length 245
Comment putative two-component response regulator, CheY-like [Azospirillum lipoferum 4B plasmid AZO_p3]
Sequence
MVEDEADLRDDLVEYLERCGFEVRGASRGAELDRLLESGPADVIVLDVNLPDEDGFSVAR
RIRASSHAAIIMLTARSSLIDRVIGLELGADVYLVKPVDFREVEAQVKALMRRMQKGTAP
LAAPEPSPAAPAPVADARKAWVFDDIEWRIQPPTGAAVPLTATEYKFLSLLVTVPGEPVS
RQDISVALTGRDWDPYSRSIDSLVRRLRIKVEERSGCALPVQAVHGVGYAFVGPVVSSVV
EDSTL
Download sequence
Identical sequences G7ZFA0
WP_014249587.1.44154 gi|374293802|ref|YP_005040825.1| gi|374293802|ref|YP_005040825.1|NC_016623

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]