SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|374999154|ref|YP_004974652.1|NC_016586 from NCBI plasmid sequences

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|374999154|ref|YP_004974652.1|NC_016586
Domain Number 1 Region: 173-358
Classification Level Classification E-value
Superfamily Methylesterase CheB, C-terminal domain 2.09e-56
Family Methylesterase CheB, C-terminal domain 0.0000222
Further Details:      
 
Domain Number 2 Region: 2-105
Classification Level Classification E-value
Superfamily CheY-like 4.41e-24
Family CheY-related 0.0092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|374999154|ref|YP_004974652.1|NC_016586
Sequence length 363
Comment Chemotaxis glutamate methylesterase CheB [Azospirillum lipoferum 4B plasmid AZO_p2]
Sequence
MLVVEDSPVIQQLLSHVIGADPRLEVAGIASSGEQALRMIERAVPDVVSLDIRLPGIDGF
EVTSRIMRQNPLPIVVVASDVRDLDIPMRALQAGALAVVEKPGSVARADYQTVAHHLCTQ
LVIMSQVKVIRHRITARPPRPANSAAPPDGAPNDAPDGGLPDAAVTADGRLRRFRAVGLV
ASTGGPAALARVLKDLSPGYPLPVFVVQHMGAPFMAGFANWLGTVSPLPVKLGEAGLVPR
PGIVYVAPGDRHMRVENGIIRLSDDPLVCGQRPSGEELFRSMARAYGASGIGVLLTGMGE
DGARGLVDMHKVGAYTIAEHASTAVIHSMPGTAVRLGGAVEELPLDRVAGRLLQLTSDDK
MAS
Download sequence
Identical sequences G7ZDG6
gi|374999154|ref|YP_004974652.1|NC_016586 gi|374999154|ref|YP_004974652.1| WP_014188925.1.44154

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]