SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|375006616|ref|YP_004975400.1|NC_016587 from NCBI plasmid sequences

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|375006616|ref|YP_004975400.1|NC_016587
Domain Number 1 Region: 174-362
Classification Level Classification E-value
Superfamily Methylesterase CheB, C-terminal domain 1.01e-61
Family Methylesterase CheB, C-terminal domain 0.0000167
Further Details:      
 
Domain Number 2 Region: 1-109
Classification Level Classification E-value
Superfamily CheY-like 1.02e-25
Family CheY-related 0.00078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|375006616|ref|YP_004975400.1|NC_016587
Sequence length 365
Comment Chemotaxis glutamate methylesterase CheB [Azospirillum lipoferum 4B plasmid AZO_p4]
Sequence
MVVDDSAVIRGLLTRALEGDPDIRVVTSVGDGQMAVNSLQRNSIDVIVLDIEMPVMDGLT
AIPKLLAVAPQVKIIMASTLTLRGADVSIRCLSAGAADYIPKPTSTREIGGAEDFKRELV
AKVKALGAAARRAGSRSRGEIRPLTPAAPVGLLKREVGPIVTRPAPAGTMAVKPDVIAIG
SSTGGPQALFEVLSHLKAGVSQPILITQHMPATFTTILAEHITRQCGIDAREAKDGEPIV
QNRCYIAPGDFHMLVAQRGGANVITLSKDPPENFCRPAVDPMMRSILKAFGGRKILACIL
TGMGQDGLKGCTDVVNGGGMLIAQDEASSVVWGMPGAVAQAGICSAILPLKEIGPHIRKL
ASRAA
Download sequence
Identical sequences G7ZH99
gi|375006616|ref|YP_004975400.1|NC_016587 gi|375006616|ref|YP_004975400.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]