SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|378764149|ref|YP_005192765.1|NC_016815 from NCBI plasmid sequences

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|378764149|ref|YP_005192765.1|NC_016815
Domain Number 1 Region: 156-343
Classification Level Classification E-value
Superfamily Methylesterase CheB, C-terminal domain 5.62e-62
Family Methylesterase CheB, C-terminal domain 0.000023
Further Details:      
 
Weak hits

Sequence:  gi|378764149|ref|YP_005192765.1|NC_016815
Domain Number - Region: 2-105
Classification Level Classification E-value
Superfamily CheY-like 0.00165
Family CheY-related 0.005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|378764149|ref|YP_005192765.1|NC_016815
Sequence length 347
Comment protein-glutamate methylesterase CheB [Sinorhizobium fredii HH103 plasmid pSfHH103e]
Sequence
MTRILLATSTPDLEERVRRAAGADAAIELVGVARSGKDAVRMTGKLLPDIVAVELRDNDT
AETVREIMIIAPTPVVMVAYQDGSQLGAISARALDSGALAVIPAPTASGTSLEKAAIERF
LSTIKAMAQVKVVRQWRKKTRGDHQVKEAPQSADDTQIAIVGIAASTGGPSAIRSILKDL
SANFPAPILIVQHMSNGFIEGVAASLDATIALKVKVGANGERLRPGTVYLAPDGHQLGVS
GKSRLRVVDDDPIQGFKPSGSYLFGSIARAFKEESLAVILTGMGDDGTEGLRALHVAGGK
VIAQDEESSVVFGMPKSAISAGLVDFVLPLDDIAGKITALASRRRQP
Download sequence
Identical sequences G9AHU4
WP_014332273.1.24350 gi|378764149|ref|YP_005192765.1|NC_016815 gi|378764149|ref|YP_005192765.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]