SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|384527781|ref|YP_005419013.1|NC_017060 from NCBI plasmid sequences

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|384527781|ref|YP_005419013.1|NC_017060
Domain Number 1 Region: 14-113
Classification Level Classification E-value
Superfamily Enzyme IIa from lactose specific PTS, IIa-lac 3.01e-34
Family Enzyme IIa from lactose specific PTS, IIa-lac 0.00045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|384527781|ref|YP_005419013.1|NC_017060
Sequence length 115
Comment PTS system N,N'-diacetylchitobiose-specific transporter subunit IIA [Rahnella aquatilis HX2 plasmid PRA1]
Sequence
MMDLDSIVETESEMQDLEEVVMGLIINSGQARSLAYAALKKAKEGDFEQARSVMVQSKMA
LNEAHLVQTQLIEGDQGEGKTKVSLVLVHAQDHLMTSMLARELIAELIELHEKIK
Download sequence
Identical sequences H8P0E9
WP_014416577.1.91760 gi|384527781|ref|YP_005419013.1|NC_017060 gi|384527781|ref|YP_005419013.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]