SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|384527969|ref|YP_005419201.1|NC_017060 from NCBI plasmid sequences

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|384527969|ref|YP_005419201.1|NC_017060
Domain Number 1 Region: 3-129
Classification Level Classification E-value
Superfamily CheY-like 2.7e-39
Family CheY-related 0.00014
Further Details:      
 
Domain Number 2 Region: 128-232
Classification Level Classification E-value
Superfamily C-terminal effector domain of the bipartite response regulators 4.33e-31
Family PhoB-like 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|384527969|ref|YP_005419201.1|NC_017060
Sequence length 240
Comment two component transcriptional regulator, winged helix family protein [Rahnella aquatilis HX2 plasmid PRA1]
Sequence
MDKTKKILIVEDDGDIAELLSLHLRDEGYEITHAADGNLGVAHLEKGGWDALILDLMLPG
VDGLEICRRARNMTRYTPIIIISARSSEVHRVLGLELGADDYLAKPFSMLELVARVKALF
RRQEAMSRNLKMDAGTLSFSGLVIDPIARDVMLNHQSVELTPREFDLLYFFAKNPGKVFS
RLSLLNQVWGYEHEGYEHTVNTHINRLRIKIETNPAEPERILTVWGKGYKFVSSSEASQG
Download sequence
Identical sequences A0A0H3FI18 H8P095
gi|384527969|ref|YP_005419201.1| gi|322835521|ref|YP_004215547.1|NC_015062 gi|384527969|ref|YP_005419201.1|NC_017060 WP_013578101.1.59798 WP_013578101.1.73690 WP_013578101.1.91760 gi|322835521|ref|YP_004215547.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]