SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|384533610|ref|YP_005716274.1|NC_017323 from NCBI plasmid sequences

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|384533610|ref|YP_005716274.1|NC_017323
Domain Number 1 Region: 7-190
Classification Level Classification E-value
Superfamily Methylesterase CheB, C-terminal domain 1.7e-51
Family Methylesterase CheB, C-terminal domain 0.00034
Further Details:      
 
Domain Number 2 Region: 271-449
Classification Level Classification E-value
Superfamily S-adenosyl-L-methionine-dependent methyltransferases 2.36e-45
Family Chemotaxis receptor methyltransferase CheR, C-terminal domain 0.00056
Further Details:      
 
Domain Number 3 Region: 826-954
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 2.65e-20
Family Heme-binding PAS domain 0.025
Further Details:      
 
Domain Number 4 Region: 204-273
Classification Level Classification E-value
Superfamily Chemotaxis receptor methyltransferase CheR, N-terminal domain 0.00000000000000314
Family Chemotaxis receptor methyltransferase CheR, N-terminal domain 0.0055
Further Details:      
 
Domain Number 5 Region: 733-835
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.000000000194
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.074
Further Details:      
 
Weak hits

Sequence:  gi|384533610|ref|YP_005716274.1|NC_017323
Domain Number - Region: 1042-1147
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 0.000466
Family alpha-ketoacid dehydrogenase kinase, C-terminal domain 0.09
Further Details:      
 
Domain Number - Region: 603-724
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.000471
Family FCH domain 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|384533610|ref|YP_005716274.1|NC_017323
Sequence length 1160
Comment MCP methyltransferase/methylesterase [Sinorhizobium meliloti BL225C plasmid pSINMEB02]
Sequence
MDRELDPPIVAIGASAGGVQALQTFFDLMPNDTGATFVVIVHLDPHARSELANILAARTR
MPVTQVENQARLESNHVYVIAPNRRLKIDDGTIAALPFEEPHAVRAPIDLFFRSLAEEHG
SEIAVILTGAGADGAIGVKAVKEAGGIVLVQDPEEAEYASMPRNAIDTEVADFVLPIREL
PHRVAELLARRDQLPSHPFRADVDDMIGRILAHVRGRTGHDFSQYKRTTILRRIGRRAQV
ARSETFADYYNYLRENPEEAQALFSDFLISVTTFFRDRSAFEALAERVIPQLFDGKEVAD
AIRVWVPGCATGEETYTMGMLLLEEAARRDLSPEIQVFGSDLDAQALRIAREGRYPSTIE
GDLSEERLRRFFQREGDHYRVRRELRDVVLFASHSLLRDPPFSHLDMISCRNLLIYLDRQ
LQQQVCNTFHYALNAGGFLFLGSSESADYPRLFLTVDREARIYRAIAGGGARPVVLPALL
GPNGSEMKSPIIRTPAAGHVSDAAVHRQMLEKIAPPSMLVDESHHAMHLSENAGRFLQPS
GGPVSTDATDLVREEFRFDLRAALHRAFERNEPTLSMPILADLDGQPHRVYLQVKPVVLG
TERTRHALVLFIEGEAIDKTQEVVLDTLDGRPTIDEAIRRLQEELQLAQNRLRLTSEESA
TATEELRAANEELQSMNEEYRSTAEELETSKEELQSINEELQTVNNELKLKLESISQAHS
DLQNLMAATDIATLFLDPSLRIKRFTPRLTEIFNVTPSDEGRPITDFTHHLKYKRLSDDA
RAVLETLRPVEHEVKSRNDGWYLVRMRPYRTMEDKIDGVVVTFLDISERRHAEEAAKESG
QRLEQEMRLVELSRSPIFVWDFDDGIMQWNRGSEELYGYSREEALGRRKEELLKTAVPGS
SFDKLRRTLSQKGRWSGELNHTTKDGRVLTVESQIELVPFGERRLVLESTRDISDRKRWE
RRGQLLLNELSHRVKNTLAVVQSLARQTLRTTRSSEDFVERFEGRLAALASAHKLLVDSE
WRGAELDALAQGQLDAYAGSDRRRLQIEGEPVTLPPDLATPFGLVLHELATNAAKYGAFS
TAIGQVRLSWKLGNNGRNLEVIWQERGGPPVEPPSEQGFGGVLIEKSLPGSTVHRDFQPG
GVVCTIDIELPEIPPDGAEK
Download sequence
Identical sequences A0A0E0UPP3
gi|384533610|ref|YP_005716274.1|NC_017323 WP_014527423.1.58221 WP_014527423.1.90968 WP_014527423.1.94084 gi|384533610|ref|YP_005716274.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]