SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|384533611|ref|YP_005716275.1|NC_017323 from NCBI plasmid sequences

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|384533611|ref|YP_005716275.1|NC_017323
Domain Number 1 Region: 4-188
Classification Level Classification E-value
Superfamily Methylesterase CheB, C-terminal domain 1.57e-51
Family Methylesterase CheB, C-terminal domain 0.0000862
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|384533611|ref|YP_005716275.1|NC_017323
Sequence length 353
Comment CheB methylesterase [Sinorhizobium meliloti BL225C plasmid pSINMEB02]
Sequence
MGRRDVIAIGGSLGAVAALKHLLGKLPGDFAAAVFVVIHVGARGKDLLAEIFNAHSGIPV
TTAVDGEAVERRHVYVAPADHHLLVIDGVIRLGRGPRENLARPAVDPLFRSIGLNYGPRS
VAVVLTGLLNDGAAGLADFKRCGGVTVVQNPSDAVAPDMPMGALRASDVDYRAPLDGLAA
LLVELTGEEAGPPIPVPAEIRLEVDIAFGRQIGSETMLTIANPVPISCPACGGVLSQIKS
WPPLRFRCQVGHAYTSEALAAESEGAVDEALRVALRIIEERVTLSEKMAQDAHRSGFAAA
AAANRRRANEGREHAETLRRAIIGSAPEATAGKLEDASLAVAKHPDPTDPESS
Download sequence
Identical sequences A0A0E0UPC2
gi|384533611|ref|YP_005716275.1|NC_017323 gi|384533611|ref|YP_005716275.1| WP_014527424.1.58221 WP_014527424.1.90968 WP_014527424.1.94084

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]