SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|384539361|ref|YP_005723445.1|NC_017326 from NCBI plasmid sequences

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|384539361|ref|YP_005723445.1|NC_017326
Domain Number 1 Region: 7-190
Classification Level Classification E-value
Superfamily Methylesterase CheB, C-terminal domain 4.97e-51
Family Methylesterase CheB, C-terminal domain 0.00027
Further Details:      
 
Domain Number 2 Region: 271-449
Classification Level Classification E-value
Superfamily S-adenosyl-L-methionine-dependent methyltransferases 5.9e-46
Family Chemotaxis receptor methyltransferase CheR, C-terminal domain 0.00053
Further Details:      
 
Domain Number 3 Region: 827-955
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 2.65e-20
Family Heme-binding PAS domain 0.025
Further Details:      
 
Domain Number 4 Region: 198-273
Classification Level Classification E-value
Superfamily Chemotaxis receptor methyltransferase CheR, N-terminal domain 8.63e-16
Family Chemotaxis receptor methyltransferase CheR, N-terminal domain 0.0059
Further Details:      
 
Domain Number 5 Region: 734-836
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.000000000224
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.077
Further Details:      
 
Weak hits

Sequence:  gi|384539361|ref|YP_005723445.1|NC_017326
Domain Number - Region: 604-725
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.00178
Family FCH domain 0.025
Further Details:      
 
Domain Number - Region: 1042-1147
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 0.00351
Family alpha-ketoacid dehydrogenase kinase, C-terminal domain 0.09
Further Details:      
 
Domain Number - Region: 508-608
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.0688
Family Flavin-binding PAS domain 0.083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|384539361|ref|YP_005723445.1|NC_017326
Sequence length 1161
Comment putative methyltransferase [Sinorhizobium meliloti SM11 plasmid pSmeSM11d]
Sequence
MGRELDPPIVAIGASAGGIQALQTFFDLIPNDTGATFVVIVHLDPHARSELANILAARTR
MSVTQVEDQARLEGNHVYVIAPNRQLKIADGTITALPFEEPHALRAPIDLFFRSLAEEHG
SELAVILTGAGADGAIGVKAVKEAGGIVLVQDPEEAEYASMPRNAIDTEVADFVLPIREL
PHRVAELLADRDQLPSEPFHADDDDMIGRILAHVRGRTGHDFSQYKRATILRRIGRRAQI
ARRETFADYYNYLRENPEEAQALFSDFLISVTTFFRDPSAFEALAERVIPQLFDGKEVAD
AIRVWVPGCATGEETYTMGMLLLEEAARRDLSPEIQVFGSDLDAQALRIAREGRYPSTIE
SDLSEERLRRFFQREGDHYRVRRELRDVVLFASHSLLRDPPFSHLDMISCRNLLIYLDRQ
LQQQVCNTFHYALNAGGFLFLGSSESADHPGLFLTVDREARIYRAVAGGGARRPMVLPAL
LGPHKPEIKSTIIRMPAAGHVSDAAVHRQMLEKIAPPSMLVDESHHAIHLSENAGRFLQP
SGGPVSTDATDLVREEFRFDLRAALHRAFERNEPTLSMPILADLDGQPHRVYLQVKPVVQ
GTERTRHALVLFIEGEAIDKTQEVVLDTLDGRPTIDEAIRRLQEELQLAQNRLRLTSEES
ATATEELRAANEELQSMNEEYRSTAEELETSKEELQSINEELQTVNSELKLKLESISRAH
SDLQNLMAATDIATLFLDPSLRIKRFTPRLTEIFNVTPSDEGRPITDFTHHLKYKRLSDD
ARAVLETLTPVEHEVKSRDDGWYLVRMRPYRTMEDKIDGVVVTFVDISERRHAEEAAKES
GQRLEQEMRLVELSRSPIFVWDFDDGIMQWNRGSEELYGYSREEALGRRKEELLKTAVPG
SSFDKLRRTLSQKGRWSGELNHTTKDGRVLTVESQIELVPFGERRLVLESTRDISDRKRW
ERRGQLLLNELSHRVKNTLAVVQSLARQTLRTTRSSEDFVERFEGRLAALASAHKLLVDS
EWRGAELDALARGQLDAYAGSDRRRLQIEGEPVTLPPDLATPFGLVLHELATNAAKYGAF
STGIGQVRLSWKLGNNGRNLGVIWQERGGPPVEPPSEQGFGGVLIEKSLPGSTVHRDFQP
DGVVCTIDIELPEIPPDGAEK
Download sequence
Identical sequences A0A222GX18 F7XHB8
gi|384539361|ref|YP_005723445.1|NC_017326 gi|384539361|ref|YP_005723445.1| WP_014530677.1.48083 WP_014530677.1.50755 WP_014530677.1.86220

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]