SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|384539362|ref|YP_005723446.1|NC_017326 from NCBI plasmid sequences

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|384539362|ref|YP_005723446.1|NC_017326
Domain Number 1 Region: 4-188
Classification Level Classification E-value
Superfamily Methylesterase CheB, C-terminal domain 5.36e-51
Family Methylesterase CheB, C-terminal domain 0.0000982
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|384539362|ref|YP_005723446.1|NC_017326
Sequence length 353
Comment protein-glutamate methylesterase [Sinorhizobium meliloti SM11 plasmid pSmeSM11d]
Sequence
MGRRDVIAIGGSLGAVAALKHLLGKLPGDFAAAVFVVVHVGARGKDLLAEIFNAHSGIPV
TTAVDGEAVERRHVYVAPADHHLLVIDGVIRLGRGPRENLARPAVDPLFRSIGLKYGPRS
VAVVLTGLLTDGAAGLADFKRCGGVTVVQNPSDAVAPDMPMGALRASDVDYRAPLDGLAA
LLVELTGEEAGPPIPVPAEIRLEVDIAFGRQIGSETMLTIANPVPISCPACGGVLSQIKS
WPPLRFRCQVGHAYTSEALAAESEGAVDETLRVALRIIEERVTLSEKMAQDAHRSGFAAA
AAANRRRANEGREYAETLRRAIIGSAPEATAGKLEDASLAVAKHPDPTDPESS
Download sequence
Identical sequences F7XHB9
gi|384539362|ref|YP_005723446.1|NC_017326 gi|384539362|ref|YP_005723446.1| WP_014530678.1.48083

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]