SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|384540599|ref|YP_005724682.1|NC_017327 from NCBI plasmid sequences

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|384540599|ref|YP_005724682.1|NC_017327
Domain Number 1 Region: 157-344
Classification Level Classification E-value
Superfamily Methylesterase CheB, C-terminal domain 6.93e-62
Family Methylesterase CheB, C-terminal domain 0.0000226
Further Details:      
 
Domain Number 2 Region: 1-107
Classification Level Classification E-value
Superfamily CheY-like 0.0000000723
Family CheY-related 0.0061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|384540599|ref|YP_005724682.1|NC_017327
Sequence length 354
Comment CheB2 chemotaxis methylesterase [Sinorhizobium meliloti SM11 plasmid pSmeSM11c]
Sequence
MVRILLATSTVELEDLVRRAIEGDASAELVLIARSGREAVRMTGELLPDIVAVELCPSGD
DSAETVREIMIAAPTPVVMLSHRDGSQLGTISARALEAGALAVIPAPAAHGMPLEQPAIE
KFLSTIKAMSQVKVVRQWRQKVRGDRAAKDQPPAARTPIGIVGIAASTGGPAAIRAILKD
ISADLPVPILIVQHMSNGFIDGVAASLNATVPLTVKVARNGELLKPGTVYLAPDNCQLGV
SGRSRLRVSDDAPVNGFKPSGSYLFGSIARAFKGESLAVVLTGMGDDGTEGLRALRMAGG
KAIAQDEKSSVVFGMPKSAIGAGLVDLVLPLESIAENITAIARGRSEPEGETRT
Download sequence
Identical sequences F7XE98
gi|384540599|ref|YP_005724682.1| WP_014531469.1.21755 WP_014531469.1.30341 WP_014531469.1.48083 WP_014531469.1.49828 WP_014531469.1.50755 WP_014531469.1.80755 WP_014531469.1.99158 gi|384540599|ref|YP_005724682.1|NC_017327

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]