SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|385839700|ref|YP_005877447.1|NC_017499 from NCBI plasmid sequences

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|385839700|ref|YP_005877447.1|NC_017499
Domain Number 1 Region: 200-362
Classification Level Classification E-value
Superfamily DNA breaking-rejoining enzymes 1.32e-34
Family Lambda integrase-like, catalytic core 0.0008
Further Details:      
 
Weak hits

Sequence:  gi|385839700|ref|YP_005877447.1|NC_017499
Domain Number - Region: 10-91
Classification Level Classification E-value
Superfamily Methylesterase CheB, C-terminal domain 0.00889
Family Methylesterase CheB, C-terminal domain 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|385839700|ref|YP_005877447.1|NC_017499
Sequence length 365
Comment Integrase [Lactobacillus salivarius CECT 5713 plasmid pHN3]
Sequence
MQKEVANKKIDELLHELPYYMNDFVIVKTADEYSPNTILEYLKNFHQFLIWLIENHYINE
NKTSDIAPESLDKLTVRTATEYKSYLLRRKKQNKKALDKNGHKEESTETLSKVTIQRNIT
ALKVIFKFLSRSANNSQEKPFLTHDVMQSIDNVADKQTLQARADALEEKLFLDDETDEYL
QYIKEVYPQSLSTQAKKFYNRDVERDLAINALMLGSGLRLSEVVNINIEDLDFENNRVAV
LRKGNKKDSVRIAAFAMEYLANYRDIRASRYRADKYEKAFFLAISRGGSKRITGSAIEKM
VSKYSKGFKVRVTPHKLRHTLATRLYKQTNNLVLTAQQLGHSSTATTTLYTHIDNDETTD
ALNSL
Download sequence
Identical sequences A0A2G4RGQ5
gi|385839700|ref|YP_005877447.1|NC_017499 WP_014573595.1.24464 WP_014573595.1.54215 gi|385839700|ref|YP_005877447.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]