SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|386335662|ref|YP_006031832.1|NC_017575 from NCBI plasmid sequences

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|386335662|ref|YP_006031832.1|NC_017575
Domain Number 1 Region: 182-370
Classification Level Classification E-value
Superfamily Methylesterase CheB, C-terminal domain 2.48e-72
Family Methylesterase CheB, C-terminal domain 0.000000279
Further Details:      
 
Domain Number 2 Region: 6-111
Classification Level Classification E-value
Superfamily CheY-like 3.42e-27
Family CheY-related 0.00000887
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|386335662|ref|YP_006031832.1|NC_017575
Sequence length 378
Comment chemotaxis-specific methylesterase [Ralstonia solanacearum Po82 plasmid megaplasmid]
Sequence
MTDKRKIQVLCIDDSALIRSILKEIINAQPDMEVVGTAPDPIIARDLIKQTNPDVLTLDV
EMPKMDGLDFLEKLMRLRPTPVVMISSLTERGSEATLRALELGAVDFVAKPKLGMRDGMN
EYADQIADKIRAAARARLRPRTAAPAAAAPAHAAHATHAAHARPEHGVAAAAPAPARTHF
SSTEKLIIVGASTGGTEAIKDFLLEMPPDCPGILIVQHMPAGFTTSFAKRLDGLCRIRVK
EAVHGERVLPGHAYIAPGDMHLSLGRSGANYVTELDQNPPVNRHRPAVDVLFRSAARNAG
ANAIGVILTGMGKDGAAGMLEMRNAGAYNVAQDEASCVVYGMPKEAVAHGGVHDILPLHQ
IGPHVLAKLSAHGRVTRV
Download sequence
Identical sequences F6G8S7
gi|386335662|ref|YP_006031832.1| WP_014618925.1.26825 WP_014618925.1.34773 WP_014618925.1.55536 WP_014618925.1.58565 WP_014618925.1.63712 WP_014618925.1.80654 WP_014618925.1.85779 WP_014618925.1.88780 gi|386335662|ref|YP_006031832.1|NC_017575

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]