SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|386854707|ref|YP_006262447.1|NC_017791 from NCBI plasmid sequences

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|386854707|ref|YP_006262447.1|NC_017791
Domain Number 1 Region: 221-417
Classification Level Classification E-value
Superfamily S-adenosyl-L-methionine-dependent methyltransferases 2.38e-46
Family Chemotaxis receptor methyltransferase CheR, C-terminal domain 0.00019
Further Details:      
 
Domain Number 2 Region: 1-137
Classification Level Classification E-value
Superfamily Methylesterase CheB, C-terminal domain 2.09e-33
Family Methylesterase CheB, C-terminal domain 0.00073
Further Details:      
 
Domain Number 3 Region: 154-224
Classification Level Classification E-value
Superfamily Chemotaxis receptor methyltransferase CheR, N-terminal domain 0.0000000000000248
Family Chemotaxis receptor methyltransferase CheR, N-terminal domain 0.003
Further Details:      
 
Domain Number 4 Region: 676-785
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.0000209
Family Flavin-binding PAS domain 0.041
Further Details:      
 
Weak hits

Sequence:  gi|386854707|ref|YP_006262447.1|NC_017791
Domain Number - Region: 793-868
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.000971
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.082
Further Details:      
 
Domain Number - Region: 616-696
Classification Level Classification E-value
Superfamily Methyl-accepting chemotaxis protein (MCP) signaling domain 0.023
Family Methyl-accepting chemotaxis protein (MCP) signaling domain 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|386854707|ref|YP_006262447.1|NC_017791
Sequence length 878
Comment MCP methyltransferase/methylesterase, partial [Deinococcus gobiensis I-0 plasmid P2]
Sequence
MPDLLTRCTIMPVVQITDGQPLRANRVHIPPPGHSLSLEGGILRLEDLTQAGGHVIDYFF
ESLAADQQGQAVGIVLSGLGRDGTRGIGAIKRAGGWVLVEDPQTAEYSDMPRSAVSTGLA
DDVQPAPELAARLMGLTDVAPLLEEALGQGGDGSSAPLQTILRLVHAHSGHNFEHYKHAM
LIRRIDRCMRERGIGDVSDYIQMLEASPDAVEALFQDFTINVTSFFRDAEAFEALKVHLR
SAIRNHGRGQNPFRVWVTACSTGEEAYSVAIVLHELAGELVGDHRPRVQVFATDIDPVVV
NTARQGLYPRDIAYIVSEERLQRFFQLRGDQYQVRAEVRNSVVFATHSTFADPPFTRLDL
VSCRNLLIYVGPELQRQILTLFRYALRPAGLLFLGSSESLGTGQQGFTILDRHWKIYERG
EGEAGRPPLNPSSPLHAGETPLSSEAALKAGPGRISSAGRPAGHLDLTPQVQSALLAEYA
PPAVVVSGQGEVLFVHGRASRYLAIPQGQVQNNVFEMVPVSLRLALRSAVREAHHAQRRV
TYRGLVAAPPGEVDTAPAQTLDLTVRPLWPAGDGPLLITLQETGEAAAEAAEAERASDAG
HSLALELELRHGREALRATVEEVTRSVVELRTSHEDLQTSHEELQSANEELMTSKEELQS
LNEELSTVNAEHQVIIQDQVRANDDLNNLLDTAGTAILFLGNDLTIRRFTPPINQLVRLM
SADVGRPLEDFNVLLRHNMLLAETQRVLETLEPHEAQVQTLDGEWFLLRINPYRTADNRI
DGVVVALTSIAVVKALEWRLVKSLNLDRAALDTRRDPLLLLDQHLRVVTASQALLTLLES
EPDTGELAFDLPELRRRLQAVIATGEPASGSAKLRIEE
Download sequence
Identical sequences H8H1H5
gi|386854707|ref|YP_006262447.1|NC_017791 gi|386854707|ref|YP_006262447.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]