SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|386854709|ref|YP_006262449.1|NC_017791 from NCBI plasmid sequences

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|386854709|ref|YP_006262449.1|NC_017791
Domain Number 1 Region: 3-188
Classification Level Classification E-value
Superfamily Methylesterase CheB, C-terminal domain 2.09e-53
Family Methylesterase CheB, C-terminal domain 0.0000579
Further Details:      
 
Weak hits

Sequence:  gi|386854709|ref|YP_006262449.1|NC_017791
Domain Number - Region: 232-260
Classification Level Classification E-value
Superfamily YfgJ-like 0.011
Family YfgJ-like 0.0086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|386854709|ref|YP_006262449.1|NC_017791
Sequence length 352
Comment Protein-glutamate methylesterase CheB [Deinococcus gobiensis I-0 plasmid P2]
Sequence
METQRVIVIGTSAGGMQPLLELAAGLPADFPAAVCIVMHIPAYIPSFLPNILGRAGPLSA
VHPANGDPILPGRIYCAPPDQHLLIENGRLNLTRGPKENRMRPAVDTLFRSAAYSAGSNV
IGVVLSGLLDDGTSGLWAIKQFGGTTVVQDPRDAQFDSMPASALNQVQIDHVVTARHLAA
LLVQLVAEPVQAPREAGMNEQVRKRLITEISIASGGHAFKKGVMTFGKVTPQTCPECGGV
LVQIQEGGFTRYRCHTGHAYTGDTLLVSVTEAIEDKLWATLRALEEASMLLENTGQEFEA
AGNARLAGEYRRRAKEMEARSALIFENVARNRSLSVEQLEYEASQKESPQSD
Download sequence
Identical sequences H8H1H7
gi|386854709|ref|YP_006262449.1| gi|386854709|ref|YP_006262449.1|NC_017791 WP_014686470.1.15941

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]