SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|392378436|ref|YP_004985596.1|NC_016594 from NCBI plasmid sequences

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|392378436|ref|YP_004985596.1|NC_016594
Domain Number 1 Region: 203-391
Classification Level Classification E-value
Superfamily Methylesterase CheB, C-terminal domain 3.01e-62
Family Methylesterase CheB, C-terminal domain 0.0000175
Further Details:      
 
Domain Number 2 Region: 25-137
Classification Level Classification E-value
Superfamily CheY-like 9.25e-27
Family CheY-related 0.00062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|392378436|ref|YP_004985596.1|NC_016594
Sequence length 394
Comment chemotaxis glutamate methylesterase CheB [Azospirillum brasilense Sp245 plasmid AZOBR_p1]
Sequence
MSDRFGRPPPPAPAGHPTGAAGGDPVRVMVVDDSAVIRGLLTRALEGDTEIRVVASVGDG
QMAVNALQRNSLDVIVLDIEMPVMDGLTAIPKLLAVAPQVKIIMASTLTLRGADISMRCL
SAGAADYIPKPTSTREIGGADAFKRELVSKVKALGAAARRAGSRTRGELRPLTPVPAAFL
KREPPPVTLRPAPAVGSVGQVKPDVIAIGSSTGGPQALFEVLAHLKTGVTQPILITQHMP
ATFTTILAEHITRQCGLNAQEAKDGEPVVSGRCYIAPGDFHMLVTQRAGANVISLTKDPP
ENFCRPAVDPMMRSILRAFGGRKVLACILTGMGQDGLKGCTEVVNAGGTLIAQDEASSVV
WGMPGAVAQAGICSAVLPLKEIGPYIRKFASRAA
Download sequence
Identical sequences G8ANN0
WP_014198313.1.1190 gi|392378436|ref|YP_004985596.1|NC_016594 gi|392378436|ref|YP_004985596.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]