SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|392379946|ref|YP_004987104.1|NC_016596 from NCBI plasmid sequences

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|392379946|ref|YP_004987104.1|NC_016596
Domain Number 1 Region: 5-187
Classification Level Classification E-value
Superfamily Methylesterase CheB, C-terminal domain 1.02e-50
Family Methylesterase CheB, C-terminal domain 0.00014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|392379946|ref|YP_004987104.1|NC_016596
Sequence length 332
Comment protein-glutamate methylesterase [Azospirillum brasilense Sp245 plasmid AZOBR_p4]
Sequence
MTDGPLIVIGASAGGLEALEALVRDLPPDLPAAVCIVLHIGDRPTAAPSILDRAGPLPAS
HARDREPLRAGHIHVAPPGCHLVVEAPRCLRLLRGPREHSTRPAVDPLFRSAARACGPAV
IGVVLSGALNDGTAGLAEIKRRGGVAVVQDPTDARYPGMPRSALDHVAVDHCVPAAAMGA
LLGRLAAERDADAAPPAASKEAPMEGMYNLNRPAALTCPDCGGALRETKVDTLPYFTCHI
GHRYGADSMEEAQLHMVEQAFEVALRALNERAALCLRLAETAQGMGQGLSAKRWDEAGRE
ARERAELLIRFLGEEWIRPPFHPGSGGAPDRF
Download sequence
Identical sequences G8AZG0
gi|392379946|ref|YP_004987104.1| gi|392379946|ref|YP_004987104.1|NC_016596 WP_014199821.1.1190

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]