SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|392380202|ref|YP_004987360.1|NC_016596 from NCBI plasmid sequences

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|392380202|ref|YP_004987360.1|NC_016596
Domain Number 1 Region: 5-118
Classification Level Classification E-value
Superfamily CheY-like 2.99e-25
Family CheY-related 0.0044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|392380202|ref|YP_004987360.1|NC_016596
Sequence length 120
Comment putative response regulator receiver (CheY-like protein) [Azospirillum brasilense Sp245 plasmid AZOBR_p4]
Sequence
MSQTFHVIVAEDDPVVAVTIAETLEERGFRVTIGRNGFDAFKIDQNDPADILITDLRMPH
FDGTSLIARMQEQRPELPILVTTGYSDNLPKEEPGQLSVVQKPFSEDSIVRAVQSLLGVA
Download sequence
Identical sequences A0A060DZU5 G8B072
gi|392380202|ref|YP_004987360.1|NC_016596 WP_014200077.1.1190 WP_014200077.1.45791 WP_014200077.1.72791 gi|392380202|ref|YP_004987360.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]