SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|392383813|ref|YP_005033009.1|NC_016618 from NCBI plasmid sequences

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|392383813|ref|YP_005033009.1|NC_016618
Domain Number 1 Region: 175-239
Classification Level Classification E-value
Superfamily C-terminal effector domain of the bipartite response regulators 4.76e-18
Family GerE-like (LuxR/UhpA family of transcriptional regulators) 0.0024
Further Details:      
 
Domain Number 2 Region: 18-142
Classification Level Classification E-value
Superfamily CheY-like 0.0000000249
Family CheY-related 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|392383813|ref|YP_005033009.1|NC_016618
Sequence length 252
Comment putative two-component transcriptional regulator, LuxR family [Azospirillum brasilense Sp245 plasmid AZOBR_p2]
Sequence
MTTDIKQQSGIAPGIAPGISVVLADPNSLTRDCFSLGLGTLCPDMTVRSVASLKDAAGVL
AQDGRTEVVLCNIGAQMGLNDGLCAAIRDAISACLPVPLVLISDRDDGGMILESLRLGVR
GYIVPNLGLGVMLEAIRLVAAGGTFVPATSLQSLIAPVPGGIAVPQTPPPGASLPATDRI
GGLTPREMAVLTCMREGKSNKLIAYMLGMCENTAKAHVRNVLKKLGATNRTEAAFMAHAH
LSRGAVLESNQP
Download sequence
Identical sequences G8AU81
gi|392383813|ref|YP_005033009.1| gi|392383813|ref|YP_005033009.1|NC_016618 WP_014241835.1.1190

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]